Property Summary

NCBI Gene PubMed Count 26
PubMed Score 111.40
PubTator Score 79.86

Knowledge Summary

Patent (4,065)

TINX Plot

  Disease (2)

Disease Target Count
Schizophrenia 503
Disease Target Count Z-score Confidence
Squamous cell carcinoma 96 4.868 2.4
Cervical cancer 23 4.487 2.2

Gene RIF (26)

PMID Text
20493543 The results of this study suggested a possible role of TAAR6 in antidepressant response and suicide behavior in patients with depressive disorder
20493543 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19766166 This study provides preliminary evidence that HSP-70 may play a role in the disrupted mechanisms that lead to BPD.
19766166 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19643584 Analysis of epistasis between a set of variations located in the TAAR6 and HSP-70 genes found weak associations with the risk of psychosis and response to antipsychotic treatment
19643584 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19582769 an epistastic effect between a set of TAAR6 and HSP-70 gene variations has a role in major mood disorders
19345712 Observational study of gene-disease association. (HuGE Navigator)
18978678 Observational study of gene-disease association. (HuGE Navigator)
18973992 Here we demonstrate that TAAR6 is not associated with schizophrenia in the ICCSS sample.
18973992 Observational study of gene-disease association. (HuGE Navigator)
18628684 Trace amine associated receptor 6 is not important for the development of schizophrenia in our family samples.
18628684 Observational study of gene-disease association. (HuGE Navigator)
18583103 We reported an association between TAAR6 (trace amine associated receptor 6 gene) variations and schizophrenia (SZ). We now report an association of a set of TAAR6 variations and clinical presentation and outcome in a sample of 240 SZ Korean patients.
18583103 Observational study of gene-disease association. (HuGE Navigator)
18198266 Observational study of gene-disease association. (HuGE Navigator)
17957234 No association of trace amine receptor genes with bipolar disorder.
17895926 although data do not provide evidence for an altered receptor activity of this TA4 polymorphism, an involvement in bipolar affective disorder cannot be excluded based on our in vitro data
17505468 Observational study of gene-disease association. (HuGE Navigator)
17505468 The trace amine associate receptor 6 (TAAR6) gene is associated with schizophrenia in the Irish study of high-density schizophrenia families.(
17097106 Observational study of gene-disease association. (HuGE Navigator)
17097106 This study strongly support association of the TAAR6 gene with susceptibility to both schizophrenia and bipolar disorder in Korean patients.
16878137 Previous studies reported TAAR expression in brain. This paper found TAAR expression only in olfactory epithelial cells and that each TAAR detects a unique set of amine ligands. TAARs seem to function as a family of chemosensory receptors for amines.
16189505 Analysis of haplotype blocks revealed no significant association of the TRAR4 region with schizophrenia.
16075187 Observational study of gene-disease association. (HuGE Navigator)
15329799 TRAR4 is preferentially expressed in those brain regions that have been implicated in the pathophysiology of schizophrenia.

AA Sequence

MSSNSSLLVAVQLCYANVNGSCVKIPFSPGSRVILYIVFGFGAVLAVFGNLLVMISILHFKQLHSPTNFL      1 - 70
VASLACADFLVGVTVMPFSMVRTVESCWYFGRSFCTFHTCCDVAFCYSSLFHLCFISIDRYIAVTDPLVY     71 - 140
PTKFTVSVSGICISVSWILPLMYSGAVFYTGVYDDGLEELSDALNCIGGCQTVVNQNWVLTDFLSFFIPT    141 - 210
FIMIILYGNIFLVARRQAKKIENTGSKTESSSESYKARVARRERKAAKTLGVTVVAFMISWLPYSIDSLI    211 - 280
DAFMGFITPACIYEICCWCAYYNSAMNPLIYALFYPWFRKAIKVIVTGQVLKNSSATMNLFSEHI         281 - 345
//

Text Mined References (26)

PMID Year Title
20493543 2010 TAAR6 variations possibly associated with antidepressant response and suicidal behavior.
19766166 2009 TAAR 6 and HSP-70 variations associated with bipolar disorder.
19643584 2009 Epistasis between a set of variations located in the TAAR6 and HSP-70 genes toward schizophrenia and response to antipsychotic treatment.
19582769 2010 Investigation of an epistastic effect between a set of TAAR6 and HSP-70 genes variations and major mood disorders.
19345712 2009 Influence of TAAR6 polymorphisms on response to aripiprazole.
18978678 2008 Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts.
18973992 2009 The trace amine associated receptor (TAAR6) gene is not associated with schizophrenia in the Irish Case-Control Study of Schizophrenia (ICCSS) sample.
18628684 2008 No support for an association with TAAR6 and schizophrenia in a linked population of European ancestry.
18583103 2008 TAAR6 variation effect on clinic presentation and outcome in a sample of schizophrenic in-patients: an open label study.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
18198266 2008 No significant association of 14 candidate genes with schizophrenia in a large European ancestry sample: implications for psychiatric genetics.
17957234 2007 No association of trace amine receptor genes with bipolar disorder.
17895926 2007 A polymorphism linked to bipolar affective disorder does not alter the CRE activity of constitutively activated trace amine receptor 4.
17505468 2007 A region of 35 kb containing the trace amine associate receptor 6 (TAAR6) gene is associated with schizophrenia in the Irish study of high-density schizophrenia families.
17097106 2008 Association of the trace amine associated receptor 6 (TAAR6) gene with schizophrenia and bipolar disorder in a Korean case control sample.
16878137 2006 A second class of chemosensory receptors in the olfactory epithelium.
16189505 2006 The trace amine receptor 4 gene is not associated with schizophrenia in a sample linked to chromosome 6q23.
16075187 2006 Failure to find association between TRAR4 and schizophrenia in the Chinese Han population.
15718104 2005 Trace amine-associated receptors form structurally and functionally distinct subfamilies of novel G protein-coupled receptors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15329799 2004 Polymorphisms in the trace amine receptor 4 (TRAR4) gene on chromosome 6q23.2 are associated with susceptibility to schizophrenia.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11459929 2001 Trace amines: identification of a family of mammalian G protein-coupled receptors.
9674972 1998 NIMH Genetics Initiative Millenium Schizophrenia Consortium: linkage analysis of African-American pedigrees.
9226366 1997 Suggestive evidence for a schizophrenia susceptibility locus on chromosome 6q and a confirmation in an independent series of pedigrees.