Property Summary

NCBI Gene PubMed Count 18
PubMed Score 12.14
PubTator Score 16.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
active ulcerative colitis 2.556 4.6e-03
ductal carcinoma in situ 1.800 4.6e-03
fibroadenoma 1.400 5.0e-03
interstitial cystitis -1.600 7.0e-04
invasive ductal carcinoma 1.800 1.7e-02
lung adenocarcinoma 1.400 2.0e-08
osteosarcoma -3.345 3.0e-06
pancreatic cancer -1.500 8.3e-04
primary pancreatic ductal adenocarcinoma -1.456 7.0e-04
tuberculosis 1.400 3.2e-07

Protein-protein Interaction (1)

Gene RIF (11)

AA Sequence

MPQRGHPSQEGLWALPSLPMAHGPKPETEGLLDLSFLTEEEQEAIAGVLQRDARLRQLEEGRVSKLRASV      1 - 70
ADPGQLKILTGDWFQEARSQRHHNAHFGSDLVRASMRRKKSTRGDQAPGHDREAEAAVKEKEEGPEPRLT     71 - 140
IDEAPQERLRETEGPDFPSPSVPLKASDPEEASQAQEDPGQGDQQVCAEEADPELEPASGGEQEPRPQQA    141 - 210
QTKAASQILENGEEAPGPDPSLDRMLSSSSSVSSLNSSTLSGSQMSLSGDAEAVQVRGSVHFALHYEPGA    211 - 280
AELRVHVIQCQGLAAARRRRSDPYVKSYLLPDKQSKRKTAVKKRNLNPVFNETLRYSVPQAELQGRVLSL    281 - 350
SVWHRESLGRNIFLGEVEVPLDTWDWGSEPTWLPLQPRVPPSPDDLPSRGLLALSLKYVPAGSEGAGLPP    351 - 420
SGELHFWVKEARDLLPLRAGSLDTYVQCFVLPDDSQASRQRTRVVRRSLSPVFNHTMVYDGFGPADLRQA    421 - 490
CAELSLWDHGALANRQLGGTRLSLGTGSSYGLQVPWMDSTPEEKQLWQALLEQPCEWVDGLLPLRTNLAP    491 - 560
RT                                                                        561 - 562
//

Text Mined References (21)

PMID Year Title