Property Summary

NCBI Gene PubMed Count 25
PubMed Score 16.34
PubTator Score 15.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
astrocytic glioma -3.100 8.3e-03
ependymoma -3.300 1.6e-02
oligodendroglioma -2.100 4.2e-02
psoriasis -1.400 2.5e-03
glioblastoma multiforme -1.500 5.1e-09
osteosarcoma 1.175 3.2e-05
sonic hedgehog group medulloblastoma -3.100 2.3e-05
medulloblastoma, large-cell -2.600 2.3e-04
primitive neuroectodermal tumor -1.600 6.0e-03
tuberculosis -1.700 2.0e-07
non-small cell lung cancer 1.235 2.5e-12
lung cancer 1.300 6.8e-04
Breast cancer 3.300 2.2e-02
adult high grade glioma -1.300 1.9e-02
atypical teratoid/rhabdoid tumor -1.300 4.7e-03
subependymal giant cell astrocytoma -2.302 3.7e-02
lung adenocarcinoma 1.107 1.7e-04
lung carcinoma 1.100 1.9e-18
Pick disease -1.500 4.4e-02
gastric carcinoma 1.200 2.1e-02
ovarian cancer 2.500 2.3e-06
pituitary cancer -1.700 2.5e-05

 IMPC Phenotype (1)

Gene RIF (9)

PMID Text
25605973 Synaptojanin 2 is a druggable mediator of metastasis and the gene is overexpressed and amplified in breast cancer.
24077433 The genetic interactions associated with ILVatrophy rate in this study may be mapping variants inSYNJ2andPI4KAthat interact to decrease synthesisof PIP.
23076136 Src-mediated phosphorylation of SYNJ2 contributes to invadopodia formation.
22213687 Single nucleotide polymorphisms in SYNJ2 are associated with personality disorders.
22045296 SYNJ2 is a novel gene in which variation is potentially associated with cognitive abilities.
21555518 SYNJ2 is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.
16102578 Identification of inactivating mutations in the JAK1, SYNJ2, and CLPTM1 genes in prostate cancer cells
15548694 contributes to the role of Rac1 in cell invasion and migration by regulating the formation of invadopodia and lamellipodia
14562116 Since Syn 2 is a phosphatidylinositol 4,5-biphosphatase involved in cell growth and rearrangement of actin filaments, the increased Syn 2 expression may correlate with the hairy cell leukemia etiology or the characteristic morphologic alterations.

AA Sequence

MALSKGLRLLGRLGAEGDCSVLLEARGRDDCLLFEAGTVATLAPEEKEVIKGQYGKLTDAYGCLGELRLK      1 - 70
SGGTSLSFLVLVTGCTSVGRIPDAEIYKITATDFYPLQEEAKEEERLIALKKILSSGVFYFSWPNDGSRF     71 - 140
DLTVRTQKQGDDSSEWGNSFFWNQLLHVPLRQHQVSCCDWLLKIICGVVTIRTVYASHKQAKACLVSRVS    141 - 210
CERTGTRFHTRGVNDDGHVSNFVETEQMIYMDDGVSSFVQIRGSVPLFWEQPGLQVGSHHLRLHRGLEAN    211 - 280
APAFDRHMVLLKEQYGQQVVVNLLGSRGGEEVLNRAFKKLLWASCHAGDTPMINFDFHQFAKGGKLEKLE    281 - 350
TLLRPQLKLHWEDFDVFTKGENVSPRFQKGTLRMNCLDCLDRTNTVQSFIALEVLHLQLKTLGLSSKPIV    351 - 420
DRFVESFKAMWSLNGHSLSKVFTGSRALEGKAKVGKLKDGARSMSRTIQSNFFDGVKQEAIKLLLVGDVY    421 - 490
GEEVADKGGMLLDSTALLVTPRILKAMTERQSEFTNFKRIRIAMGTWNVNGGKQFRSNVLRTAELTDWLL    491 - 560
DSPQLSGATDSQDDSSPADIFAVGFEEMVELSAGNIVNASTTNKKMWGEQLQKAISRSHRYILLTSAQLV    561 - 630
GVCLYIFVRPYHVPFIRDVAIDTVKTGMGGKAGNKGAVGIRFQFHSTSFCFICSHLTAGQSQVKERNEDY    631 - 700
KEITQKLCFPMGRNVFSHDYVFWCGDFNYRIDLTYEEVFYFVKRQDWKKLLEFDQLQLQKSSGKIFKDFH    701 - 770
EGAINFGPTYKYDVGSAAYDTSDKCRTPAWTDRVLWWRKKHPFDKTAGELNLLDSDLDVDTKVRHTWSPG    771 - 840
ALQYYGRAELQASDHRPVLAIVEVEVQEVDVGARERVFQEVSSFQGPLDATVVVNLQSPTLEEKNEFPED    841 - 910
LRTELMQTLGSYGTIVLVRINQGQMLVTFADSHSALSVLDVDGMKVKGRAVKIRPKTKDWLKGLREEIIR    911 - 980
KRDSMAPVSPTANSCLLEENFDFTSLDYESEGDILEDDEDYLVDEFNQPGVSDSELGGDDLSDVPGPTAL    981 - 1050
APPSKSPALTKKKQHPTYKDDADLVELKRELEAVGEFRHRSPSRSLSVPNRPRPPQPPQRPPPPTGLMVK   1051 - 1120
KSASDASISSGTHGQYSILQTARLLPGAPQQPPKARTGISKPYNVKQIKTTNAQEAEAAIRCLLEARGGA   1121 - 1190
SEEALSAVAPRDLEASSEPEPTPGAAKPETPQAPPLLPRRPPPRVPAIKKPTLRRTGKPLSPEEQFEQQT   1191 - 1260
VHFTIGPPETSVEAPPVVTAPRVPPVPKPRTFQPGKAAERPSHRKPASDEAPPGAGASVPPPLEAPPLVP   1261 - 1330
KVPPRRKKSAPAAFHLQVLQSNSQLLQGLTYNSSDSPSGHPPAAGTVFPQGDFLSTSSATSPDSDGTKAM   1331 - 1400
KPEAAPLLGDYQDPFWNLLHHPKLLNNTWLSKSSDPLDSGTRSPKRDPIDPVSAGASAAKAELPPDHEHK   1401 - 1470
TLGHWVTISDQEKRTALQVFDPLAKT                                               1471 - 1496
//

Text Mined References (29)

PMID Year Title
25605973 2015 Synaptojanin 2 is a druggable mediator of metastasis and the gene is overexpressed and amplified in breast cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24077433 2014 Genetic interactions within inositol-related pathways are associated with longitudinal changes in ventricle size.
23300701 2012 Genome-wide search for gene-gene interactions in colorectal cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23076136 Regulation of synaptojanin 2 5'-phosphatase activity by Src.
22823124 2013 The genetic aetiology of cannabis use initiation: a meta-analysis of genome-wide association studies and a SNP-based heritability estimation.
22213687 2012 Longevity candidate genes and their association with personality traits in the elderly.
22045296 2012 Evolutionary conserved longevity genes and human cognitive abilities in elderly cohorts.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
21269460 2011 Initial characterization of the human central proteome.
20936779 2010 A human MAP kinase interactome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
17562712 2007 Role of the guanine nucleotide exchange factor Ost in negative regulation of receptor endocytosis by the small GTPase Rac1.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16102578 2005 Identification of inactivating mutations in the JAK1, SYNJ2, and CLPTM1 genes in prostate cancer cells using inhibition of nonsense-mediated decay and microarray analysis.
15548694 2004 Role of synaptojanin 2 in glioma cell migration and invasion.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15090612 2004 CIN85 associates with multiple effectors controlling intracellular trafficking of epidermal growth factor receptors.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
14562116 2003 Synaptojanin 2 is recognized by HLA class II-restricted hairy cell leukemia-specific T cells.
12805586 2003 The SAC domain-containing protein gene family in Arabidopsis.
12699622 2003 Synaptojanin 2 functions at an early step of clathrin-mediated endocytosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421765 2002 Protein-protein interactions between large proteins: two-hybrid screening using a functionally classified library composed of long cDNAs.
11498538 2001 Identification and characterization of a synaptojanin 2 splice isoform predominantly expressed in nerve terminals.
11084340 2000 Synaptojanin 2, a novel Rac1 effector that regulates clathrin-mediated endocytosis.
9205841 1997 Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.