Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.83
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ependymoma 4679 4.2e-10
atypical teratoid/rhabdoid tumor 357 4.2e-05
glioblastoma 5792 9.2e-05
Astrocytoma, Pilocytic 3081 1.4e-04
adult high grade glioma 3801 2.0e-02
Disease Target Count Z-score Confidence
Huntington's disease 76 3.036 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma -1.100 2.0e-02
Astrocytoma, Pilocytic -1.300 1.4e-04
atypical teratoid/rhabdoid tumor -1.300 4.2e-05
ependymoma -1.300 4.2e-10
glioblastoma -1.200 9.2e-05

Gene RIF (1)

AA Sequence

MESLSELQNPLLPRSPAHLHGPYPYPETPPSWSCQEKLYSYLLGGAGPAGAHQLLDPGSLQLAVEAWYRP      1 - 70
SCLLGRDKVKEPRAGSCETSFTEDREPQEGPPEQPTGPGQAAENVTIQTVSYGVQEELRDQEDDQEEEES     71 - 140
DATSTESESEDNFLTLPPRDHLGLTLFSMLCCFWPLGIAAFYFSQGTSKAISKGDFRLASTTSRRALFLA    141 - 210
TLAIAVGAGLYVAVVVALAAYMSQNGHG                                              211 - 238
//

Text Mined References (6)

PMID Year Title