Property Summary

NCBI Gene PubMed Count 5
PubMed Score 6.73
PubTator Score 1.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 6.4e-18
Disease Target Count Z-score Confidence
Infertility 188 3.184 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.700 6.4e-18

Synonym

Accession A1L190
Symbols THEG2
C22orf41

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MDDADPEERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFVNCK      1 - 70
EEMEKNWQELLHETKQRL                                                         71 - 88
//

Text Mined References (5)

PMID Year Title