Property Summary

NCBI Gene PubMed Count 5
PubMed Score 6.63
PubTator Score 1.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 6.4e-18
Disease Target Count Z-score Confidence
Infertility 163 3.198 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.700 6.4e-18

Synonym

Accession A1L190
Symbols THEG2
C22orf41

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
19323366 Cloning and expression analysis of a similar gene in mouse.

AA Sequence

MDDADPEERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFVNCK      1 - 70
EEMEKNWQELLHETKQRL                                                         71 - 88
//

Text Mined References (5)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21637789 2011 A novel mouse synaptonemal complex protein is essential for loading of central element proteins, recombination, and fertility.
19323366 2009 [Cloning and expression of a novel mouse testis gene TSEG-2].
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.