Property Summary

NCBI Gene PubMed Count 14
PubMed Score 12.33
PubTator Score 9.58

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
22975310 syntabulin could be a novel effector of Epac2 and play a critical role in cAMP-enhanced insulin secretion
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16750881 Functional characterization of the mouse Golsyn/Syntabulin ortholog.

AA Sequence

MGPLRESKKEHRVQHHDKEISRSRIPRLILRPHMPQQQHKVSPASESPFSEEESREFNPSSSGRSARTVS      1 - 70
SNSFCSDDTGCPSSQSVSPVKTPSDAGNSPIGFCPGSDEGFTRKKCTIGMVGEGSIQSSRYKKESKSGLV     71 - 140
KPGSEADFSSSSSTGSISAPEVHMSTAGSKRSSSSRNRGPHGRSNGASSHKPGSSPSSPREKDLLSMLCR    141 - 210
NQLSPVNIHPSYAPSSPSSSNSGSYKGSDCSPIMRRSGRYMSCGENHGVRPPNPEQYLTPLQQKEVTVRH    211 - 280
LKTKLKESERRLHERESEIVELKSQLARMREDWIEEECHRVEAQLALKEARKEIKQLKQVIETMRSSLAD    281 - 350
KDKGIQKYFVDINIQNKKLESLLQSMEMAHSGSLRDELCLDFPCDSPEKSLTLNPPLDTMADGLSLEEQV    351 - 420
TGEGADRELLVGDSIANSTDLFDEIVTATTTESGDLELVHSTPGANVLELLPIVMGQEEGSVVVERAVQT    421 - 490
DVVPYSPAISELIQSVLQKLQDPCPSSLASPDESEPDSMESFPESLSALVVDLTPRNPNSAILLSPVETP    491 - 560
YANVDAEVHANRLMRELDFAACVEERLDGVIPLARGGVVRQYWSSSFLVDLLAVAAPVVPTVLWAFSTQR    561 - 630
GGTDPVYNIGALLRGCCVVALHSLRRTAFRIKT                                         631 - 663
//

Text Mined References (18)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22975310 2012 The microtubule associated protein syntabulin is required for glucose-stimulated and cAMP-potentiated insulin secretion.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17611281 2007 Syntabulin-kinesin-1 family member 5B-mediated axonal transport contributes to activity-dependent presynaptic assembly.
16750881 2006 Expression of m-Golsyn/Syntabulin gene during mouse brain development.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16157705 2005 Syntabulin-mediated anterograde transport of mitochondria along neuronal processes.
15656992 2005 Molecular cloning and characterization of gene for Golgi-localized syntaphilin-related protein on human chromosome 8q23.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15459722 2004 Syntabulin is a microtubule-associated protein implicated in syntaxin transport in neurons.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
10819331 2000 Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.