Property Summary

NCBI Gene PubMed Count 36
PubMed Score 20.58
PubTator Score 25.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
cutaneous lupus erythematosus -1.200 2.3e-02
osteosarcoma 1.941 5.5e-04
atypical teratoid / rhabdoid tumor 1.300 1.2e-04
glioblastoma 1.700 8.5e-03
sonic hedgehog group medulloblastoma 1.600 1.1e-03
medulloblastoma, large-cell 1.300 1.3e-02
primitive neuroectodermal tumor 1.400 1.7e-03
adrenocortical carcinoma -1.216 1.6e-02
Common variable immunodeficiency -1.079 1.4e-03
intraductal papillary-mucinous adenoma (... -1.100 2.5e-02
colon cancer -2.700 8.2e-06
pediatric high grade glioma 1.300 1.2e-02
pilocytic astrocytoma 2.700 8.7e-10
subependymal giant cell astrocytoma 3.728 4.2e-03
COPD -1.100 8.6e-04
lung carcinoma -1.300 2.7e-16
Breast cancer -1.100 4.2e-05
gastric carcinoma 1.900 1.6e-02
invasive ductal carcinoma -1.100 4.7e-02
dermatomyositis -1.600 4.7e-03

 GO Function (1)

Gene RIF (18)

PMID Text
25684206 SVIL regulates neuronal maturation by controlling LSD1+8a mediated histone H3K9 demethylation.
25605665 These results position archvillin as a mechanically sensitive component of the dystrophin complex and demonstrate that signaling defects caused by loss of gamma-SG occur both at the sarcolemma and in the nucleus.
24088567 Supervillin concentrates activated and total myosin II at the furrow, and simultaneous knockdown of supervillin and anillin additively increases cell division failure.
23750008 An actin/myosin-II-binding protein, supervillin (SVIL), is a substrate of PLK1.
23382381 adhesion regulatory protein supervillin increases cell survival by decreasing levels of the tumor suppressor protein p53 and downstream target genes
22550155 Human genome-wide association and mouse knockout approaches identify platelet supervillin as an inhibitor of thrombus formation under shear stress.
21070852 supervillin is a novel molecule that associates with KIR2DL1 receptor and regulates the inhibitory signaling in NK cells.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20331534 supervillin, F-actin and associated proteins coordinate a rapid, basolateral membrane recycling pathway that contributes to ERK signaling and actin-based cell motility
20309963 Supervillin, like its interactors, is important for efficient cytokinesis.
19683541 The first NMR solution structure and (15)N-relaxation analysis of a villin-type headpiece domain natively devoid of F-actin binding activity, that of supervillin headpiece (SVHP), is shown.
19109420 SV is a component of podosomes and invadopodia and SV plays a role in invadopodial function, perhaps as a mediator of cortactin localization, activation state, and/or dynamics of metalloproteinases at the ventral cell surface.
19047128 Observational study of gene-disease association. (HuGE Navigator)
18984674 Observational study of gene-disease association. (HuGE Navigator)
18639526 These data suggest a model in which archvillin attaches directly to the Z-line of skeletal muscle through an interaction with the nebulin C-terminus.
16385451 Observational study of gene-disease association. (HuGE Navigator)
12711699 archvillin is among the first costameric proteins to assemble during myogenesis and that it contributes to myogenic membrane structure and differentiation.
11792840 Supervillin associates with androgen receptor and modulates its transcriptional activity.

AA Sequence

MKRKERIARRLEGIENDTQPILLQSCTGLVTHRLLEEDTPRYMRASDPASPHIGRSNEEEETSDSSLEKQ      1 - 70
TRSKYCTETSGVHGDSPYGSGTMDTHSLESKAERIARYKAERRRQLAEKYGLTLDPEADSEYLSRYTKSR     71 - 140
KEPDAVEKRGGKSDKQEESSRDASSLYPGTETMGLRTCAGESKDYALHVGDGSSDPEVLLNIENQRRGQE    141 - 210
LSATRQAHDLSPAAESSSTFSFSGRDSSFTEVPRSPKHAHSSSLQQAASRSPSFGDPQLSPEARPSTGKP    211 - 280
KHEWFLQKDSEGDTPSLINWPSRVKVREKLVKEESARNSPELASESVTQRRHQPAPVHYVSFQSEHSAFD    281 - 350
RVPSKAAGSTRQPIRGYVQPADTGHTAKLVTPETPENASECSWVASATQNVPKPPSLTVLEGDGRDSPVL    351 - 420
HVCESKAEEEEGEGEGEEKEEDVCFTEALEQSKKTLLALEGDGLVRSPEDPSRNEDFGKPAVSTVTLEHQ    421 - 490
KELENVAQPPQAPHQPTERTGRSEMVLYIQSEPVSQDAKPTGHNREASKKRKVRTRSLSDFTGPPQLQAL    491 - 560
KYKDPASRRELELPSSKTEGPYGEISMLDTKVSVAQLRSAFLASANACRRPELKSRVERSAEGPGLPTGV    561 - 630
ERERGSRKPRRYFSPGESRKTSERFRTQPITSAERKESDRCTSHSETPTVDDEEKVDERAKLSVAAKRLL    631 - 700
FREMEKSFDEQNVPKRRSRNTAVEQRLRRLQDRSLTQPITTEEVVIAATEPIPASCSGGTHPVMARLPSP    701 - 770
TVARSAVQPARLQASAHQKALAKDQTNEGKELAEQGEPDSSTLSLAEKLALFNKLSQPVSKAISTRNRID    771 - 840
TRQRRMNARYQTQPVTLGEVEQVQSGKLIPFSPAVNTSVSTVASTVAPMYAGDLRTKPPLDHNASATDYK    841 - 910
FSSSIENSDSPVRSILKSQAWQPLVEGSENKGMLREYGETESKRALTGRDSGMEKYGSFEEAEASYPILN    911 - 980
RAREGDSHKESKYAVPRRGSLERANPPITHLGDEPKEFSMAKMNAQGNLDLRDRLPFEEKVEVENVMKRK    981 - 1050
FSLRAAEFGEPTSEQTGTAAGKTIAQTTAPVSWKPQDSSEQPQEKLCKNPCAMFAAGEIKTPTGEGLLDS   1051 - 1120
PSKTMSIKERLALLKKSGEEDWRNRLSRRQEGGKAPASSLHTQEAGRSLIKKRVTESRESQMTIEERKQL   1121 - 1190
ITVREEAWKTRGRGAANDSTQFTVAGRMVKKGLASPTAITPVASPICGKTRGTTPVSKPLEDIEARPDMQ   1191 - 1260
LESDLKLDRLETFLRRLNNKVGGMHETVLTVTGKSVKEVMKPDDDETFAKFYRSVDYNMPRSPVEMDEDF   1261 - 1330
DVIFDPYAPKLTSSVAEHKRAVRPKRRVQASKNPLKMLAAREDLLQEYTEQRLNVAFMESKRMKVEKMSS   1331 - 1400
NSNFSEVTLAGLASKENFSNVSLRSVNLTEQNSNNSAVPYKRLMLLQIKGRRHVQTRLVEPRASALNSGD   1401 - 1470
CFLLLSPHCCFLWVGEFANVIEKAKASELATLIQTKRELGCRATYIQTIEEGINTHTHAAKDFWKLLGGQ   1471 - 1540
TSYQSAGDPKEDELYEAAIIETNCIYRLMDDKLVPDDDYWGKIPKCSLLQPKEVLVFDFGSEVYVWHGKE   1541 - 1610
VTLAQRKIAFQLAKHLWNGTFDYENCDINPLDPGECNPLIPRKGQGRPDWAIFGRLTEHNETILFKEKFL   1611 - 1680
DWTELKRSNEKNPGELAQHKEDPRTDVKAYDVTRMVSMPQTTAGTILDGVNVGRGYGLVEGHDRRQFEIT   1681 - 1750
SVSVDVWHILEFDYSRLPKQSIGQFHEGDAYVVKWKFMVSTAVGSRQKGEHSVRAAGKEKCVYFFWQGRH   1751 - 1820
STVSEKGTSALMTVELDEERGAQVQVLQGKEPPCFLQCFQGGMVVHSGRREEEEENVQSEWRLYCVRGEV   1821 - 1890
PVEGNLLEVACHCSSLRSRTSMVVLNVNKALIYLWHGCKAQAHTKEVGRTAANKIKEQCPLEAGLHSSSK   1891 - 1960
VTIHECDEGSEPLGFWDALGRRDRKAYDCMLQDPGSFNFAPRLFILSSSSGDFAATEFVYPARAPSVVSS   1961 - 2030
MPFLQEDLYSAPQPALFLVDNHHEVYLWQGWWPIENKITGSARIRWASDRKSAMETVLQYCKGKNLKKPA   2031 - 2100
PKSYLIHAGLEPLTFTNMFPSWEHREDIAEITEMDTEVSNQITLVEDVLAKLCKTIYPLADLLARPLPEG   2101 - 2170
VDPLKLEIYLTDEDFEFALDMTRDEYNALPAWKQVNLKKAKGLF                             2171 - 2214
//

Text Mined References (47)

PMID Year Title
25684206 2015 A specific LSD1/KDM1A isoform regulates neuronal differentiation through H3K9 demethylation.
25605665 2015 Gamma-sarcoglycan is required for the response of archvillin to mechanical stimulation in skeletal muscle.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24088567 2013 Supervillin binding to myosin II and synergism with anillin are required for cytokinesis.
23750008 2013 The role of PLK1-phosphorylated SVIL in myosin II activation and cytokinetic furrowing.
23382381 2013 Supervillin-mediated suppression of p53 protein enhances cell survival.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22550155 2012 Human genome-wide association and mouse knockout approaches identify platelet supervillin as an inhibitor of thrombus formation under shear stress.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21070852 2011 Association of supervillin with KIR2DL1 regulates the inhibitory signaling of natural killer cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20331534 2010 The membrane-associated protein, supervillin, accelerates F-actin-dependent rapid integrin recycling and cell motility.
20309963 2010 Novel interactors and a role for supervillin in early cytokinesis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19683541 2009 How to arm a supervillin: designing F-actin binding activity into supervillin headpiece.
19109420 2009 Supervillin reorganizes the actin cytoskeleton and increases invadopodial efficiency.
19047128 2008 Single nucleotide polymorphisms of microRNA machinery genes modify the risk of renal cell carcinoma.
19010793 2009 Genome-wide association analysis of susceptibility and clinical phenotype in multiple sclerosis.
18984674 2009 KIF5B gene sequence variation and response of cardiac stroke volume to regular exercise.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18639526 2008 Archvillin anchors in the Z-line of skeletal muscle via the nebulin C-terminus.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18088087 2008 Phosphoproteome of resting human platelets.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17925381 2007 Supervillin slows cell spreading by facilitating myosin II activation at the cell periphery.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16880273 2006 Supervillin modulation of focal adhesions involving TRIP6/ZRP-1.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15383618 2004 Smooth muscle archvillin: a novel regulator of signaling and contractility in vascular smooth muscle.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12917436 2003 F-actin and myosin II binding domains in supervillin.
12711699 2003 Archvillin, a muscle-specific isoform of supervillin, is an early expressed component of the costameric membrane skeleton.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12202484 2002 Proteomic analysis of a detergent-resistant membrane skeleton from neutrophil plasma membranes.
11977079 2002 Villin-type headpiece domains show a wide range of F-actin-binding affinities.
11792840 2002 Supervillin associates with androgen receptor and modulates its transcriptional activity.
11707406 2001 Proteomic and functional evidence for a P2X7 receptor signalling complex.
10362542 1999 Domain analysis of supervillin, an F-actin bundling plasma membrane protein with functional nuclear localization signals.
9867483 1998 Cloning, characterization, and chromosomal localization of human superillin (SVIL).
9382871 1997 Supervillin (p205): A novel membrane-associated, F-actin-binding protein in the villin/gelsolin superfamily.