Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.75
PubTator Score 0.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.7e-08
psoriasis 6694 8.1e-05
Pick disease 1894 8.4e-05
osteosarcoma 7950 5.5e-04
medulloblastoma, large-cell 6241 6.2e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (5)

Disease log2 FC p
medulloblastoma, large-cell -1.100 6.2e-04
osteosarcoma -1.143 5.5e-04
ovarian cancer -2.100 1.7e-08
Pick disease -1.400 8.4e-05
psoriasis -2.000 8.1e-05

Gene RIF (3)

AA Sequence

MNLQRYWGEIPISSSQTNRSSFDLLPREFRLVEVHDPPLHQPSANKPKPPTMLDIPSEPCSLTIHTIQLI      1 - 70
QHNRRLRNLIATAQAQNQQQTEGVKTEESEPLPSCPGSPPLPDDLLPLDCKNPNAPFQIRHSDPESDFYR     71 - 140
GKGEPVTELSWHSCRQLLYQAVATILAHAGFDCANESVLETLTDVAHEYCLKFTKLLRFAVDREARLGQT    141 - 210
PFPDVMEQVFHEVGIGSVLSLQKFWQHRIKDYHSYMLQISKQLSEEYERIVNPEKATEDAKPVKIKEEPV    211 - 280
SDITFPVSEELEADLASGDQSLPMGVLGAQSERFPSNLEVEASPQASSAEVNASPLWNLAHVKMEPQESE    281 - 350
EGNVSGHGVLGSDVFEEPMSGMSEAGIPQSPDDSDSSYGSHSTDSLMGSSPVFNQRCKKRMRKI          351 - 414
//

Text Mined References (21)

PMID Year Title