Property Summary

NCBI Gene PubMed Count 19
PubMed Score 69.12
PubTator Score 23.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma 1.200 3.2e-05
psoriasis -1.600 5.0e-05
group 3 medulloblastoma 1.600 8.1e-04
primitive neuroectodermal tumor 1.100 7.7e-04
juvenile dermatomyositis 1.082 6.7e-12
primary pancreatic ductal adenocarcinoma 1.039 3.5e-02
tuberculosis -1.200 1.5e-03
intraductal papillary-mucinous adenoma (... 1.400 6.4e-05
intraductal papillary-mucinous carcinoma... 1.100 3.5e-03
Pick disease -1.200 1.2e-05
progressive supranuclear palsy -1.300 6.1e-03
ovarian cancer 2.000 2.0e-05
pancreatic cancer 1.100 8.4e-03

Synonym

Accession Q8NEM7 E7ER46 Q71RF3 Q9Y6A6
Symbols C13
FP757
P38IP
SPT20
FAM48A
C13orf19

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (7)

PMID Text
24220028 p38IP inhibits ubiquitination-induced GCN5 degradation and therefore promotes alpha-tubulin acetylation, facilitating spindle formation and G2/M progression.
19893488 Manipulation of p38IP and p38alpha alters mAtg9 localization, suggesting p38alpha regulates, through p38IP, the starvation-induced mAtg9 trafficking to forming autophagosomes.
19114550 hSPT20 and other hSAGA subunits, together with RNA polymerase II, are specifically recruited to genes induced by endoplasmic reticulum (ER) stress.
16685401 C13orf19 is expressed independently of the androgen. No interaction between C13orf19 and p38MAPK was identified.
15978328 C13orf19 mRNA is down-regulated in matched prostate tissues compared to prostate carcinoma tissues
12070015 Novel transcription factors identified in human CD34 antigen-positive hematopoietic stem cells.
11340631 mRNA is down-regulated in human prostate cancer, also described as C13

AA Sequence

MQQALELALDRAEYVIESARQRPPKRKYLSSGRKSVFQKLYDLYIEECEKEPEVKKLRRNVNLLEKLVMQ      1 - 70
ETLSCLVVNLYPGNEGYSLMLRGKNGSDSETIRLPYEEGELLEYLDAEELPPILVDLLEKSQVNIFHCGC     71 - 140
VIAEIRDYRQSSNMKSPGYQSRHILLRPTMQTLICDVHSITSDNHKWTQEDKLLLESQLILATAEPLCLD    141 - 210
PSIAVTCTANRLLYNKQKMNTRPMKRCFKRYSRSSLNRQQDLSHCPPPPQLRLLDFLQKRKERKAGQHYD    211 - 280
LKISKAGNCVDMWKRSPCNLAIPSEVDVEKYAKVEKSIKSDDSQPTVWPAHDVKDDYVFECEAGTQYQKT    281 - 350
KLTILQSLGDPLYYGKIQPCKADEESDSQMSPSHSSTDDHSNWFIIGSKTDAERVVNQYQELVQNEAKCP    351 - 420
VKMSHSSSGSASLSQVSPGKETDQTETVSVQSSVLGKGVKHRPPPIKLPSSSGNSSSGNYFTPQQTSSFL    421 - 490
KSPTPPPSSKPSSIPRKSSVDLNQVSMLSPAALSPASSSQRTTATQVMANSAGLNFINVVGSVCGAQALM    491 - 560
SGSNPMLGCNTGAITPAGINLSGLLPSGGLLPNALPSAMQAASQAGVPFGLKNTSSLRPLNLLQLPGGSL    561 - 630
IFNTLQQQQQQLSQFTPQQPQQPTTCSPQQPGEQGSEQGSTSQEQALSAQQAAVINLTGVGSFMQSQAAV    631 - 700
LSQLGSAENRPEQSLPQQRFQLSSAFQQQQQQIQQLRFLQHQMAMAAAAAQTAQLHHHRHTGSQSKSKMK    701 - 770
RGTPTTPKF                                                                 771 - 779
//

Text Mined References (22)

PMID Year Title
24220028 2013 The p38-interacting protein (p38IP) regulates G2/M progression by promoting ?-tubulin acetylation via inhibiting ubiquitination-induced degradation of the acetyltransferase GCN5.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
20936779 2010 A human MAP kinase interactome.
19893488 2010 Coordinated regulation of autophagy by p38alpha MAPK through mAtg9 and p38IP.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19114550 2009 The human SPT20-containing SAGA complex plays a direct role in the regulation of endoplasmic reticulum stress-induced genes.
18838386 2008 Human ATAC Is a GCN5/PCAF-containing acetylase complex with a novel NC2-like histone fold module that interacts with the TATA-binding protein.
16751104 2006 p38 and a p38-interacting protein are critical for downregulation of E-cadherin during mouse gastrulation.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16685401 2006 Functional analyses of C13orf19/P38IP in prostate cell lines.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15978328 2005 Quantification of C13orf19/P38IP mRNA expression by quantitative real-time PCR in patients with urological malignancies.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12070015 2002 Novel transcription factors in human CD34 antigen-positive hematopoietic cells.
11340631 2001 Identification of a novel gene on chromosome 13 between BRCA-2 and RB-1.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.