Property Summary

NCBI Gene PubMed Count 128
PubMed Score 136.72
PubTator Score 126.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 7.1e-04
psoriasis 6694 7.4e-03
ependymoma 4679 8.0e-03
Disease Target Count Z-score Confidence
Cancer 2499 3.326 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
ependymoma -1.100 8.0e-03
osteosarcoma -1.024 7.1e-04
psoriasis -1.300 7.4e-03

Protein-protein Interaction (2)

PDB (23)

Gene RIF (87)

AA Sequence

MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINET      1 - 70
DTPAQLEMEDEDTIDVFQQQTGGVY                                                  71 - 95
//

Text Mined References (140)

PMID Year Title