Property Summary

Ligand Count 1
NCBI Gene PubMed Count 72
PubMed Score 932.95
PubTator Score 160.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
active ulcerative colitis 2.495 3.8e-02
cutaneous lupus erythematosus -1.100 8.7e-03
cystic fibrosis -1.400 1.2e-03
Endometriosis -1.455 4.2e-02
lung cancer 1.200 7.3e-03
malignant mesothelioma -3.800 1.6e-08
psoriasis 1.100 6.4e-16
uncontrolled asthma -1.100 2.6e-02

Synonym

Accession P49888 Q8N6X5
Symbols EST
STE
EST-1
ST1E1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Component (1)

Gene RIF (50)

AA Sequence

MNSELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCK      1 - 70
EDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYY     71 - 140
FFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFL    141 - 210
ERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKLSPFMRKGITGDWKNHFTVALNEKFDKHYE    211 - 280
QQMKESTLKFRTEI                                                            281 - 294
//

Text Mined References (72)

PMID Year Title