Property Summary

NCBI Gene PubMed Count 52
PubMed Score 272.99
PubTator Score 154.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytoma -2.200 1.4e-03
atypical teratoid / rhabdoid tumor -2.100 4.1e-05
Breast cancer 2.600 2.7e-02
glioblastoma -1.600 4.8e-02
hereditary spastic paraplegia -1.081 5.0e-03
lung cancer -1.500 1.6e-02
medulloblastoma, large-cell -1.700 3.4e-04
Multiple myeloma 1.092 7.4e-03
nasopharyngeal carcinoma 1.300 1.0e-03
osteosarcoma 1.454 4.4e-03
ovarian cancer -1.800 7.2e-05
pancreatic cancer 1.100 2.6e-03
Parkinson's disease -1.400 1.7e-02
Pick disease -1.400 5.0e-03
Pneumonia -1.300 1.8e-02
primary pancreatic ductal adenocarcinoma 1.229 2.5e-03
primary Sjogren syndrome 1.100 2.4e-02
psoriasis 1.100 1.7e-48
tuberculosis and treatment for 3 months 1.200 5.5e-04

Gene RIF (26)

AA Sequence

MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMR      1 - 70
YVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL                  71 - 127
//

Text Mined References (66)

PMID Year Title