Property Summary

NCBI Gene PubMed Count 26
PubMed Score 375.21
PubTator Score 259.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
medulloblastoma, large-cell -1.600 9.5e-05
tuberculosis 2.200 1.9e-10
intraductal papillary-mucinous neoplasm ... -1.100 9.7e-03
group 4 medulloblastoma -1.300 5.0e-04
ovarian cancer -1.700 4.5e-09

Gene RIF (16)

PMID Text
27094127 Stx8 is required for proper and timely sorting and trafficking of cytotoxic molecules to functional lytic granules through the endosomal pathway in human cytotoxic t-lymphocytes.
25523146 Increased STX8 expression in visceral adipose tissue appears to be associated with the presence of type 2 diabetes in obese patients through a mechanism that may involve GLUT4.
25404741 Syntaxin 8 has a role in regulating platelet dense granule secretion, aggregation, and thrombus stability
24743596 Syntaxin-8 regulates the endocytosis of TASK-1.
24659781 These results suggest that STX8 mediates the recycling of CLDN16 and constitutes an important component of the CLDN16 trafficking machinery in the kidney.
22875976 Yeast two hybrid assay identifies the HIV-1 Nef-interacting protein syntaxin 8
22721673 Yeast two hybrid assay identifies the HIV-1 Nef-interacting protein syntaxin 8
20886065 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19422935 Observational study of gene-disease association. (HuGE Navigator)
19174780 Observational study of gene-disease association. (HuGE Navigator)
18980942 Palmitoylation does not affect the rate of protein turnover of syntaxins 7 and 8 nor does it influence the steady-state localization of syntaxin 8 in late endosomes.
18570918 Results report that syntaxin 7, syntaxin 8, vti1b and VAMP8 physically and functionally interact with CFTR.
17965969 Has two functionally distinct di-leucine-based motifs that act independently in its endocytic and exocytic processes.
15039462 syntaxin 8 contributes to the regulation of CFTR trafficking and chloride channel activity by the SNARE machinery
14991845 There are increases in CARB localized to intraneuronal neurofibrillary tangles and granulovacuolar degeneration in susceptible hippocampal and cortical neurons in Alzheimer's disease.

AA Sequence

MAPDPWFSTYDSTCQIAQEIAEKIQQRNQYERKGEKAPKLTVTIRALLQNLKEKIALLKDLLLRAVSTHQ      1 - 70
ITQLEGDRRQNLLDDLVTRERLLLASFKNEGAEPDLIRSSLMSEEAKRGAPNPWLFEEPEETRGLGFDEI     71 - 140
RQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEKLRNETRRVNMVDRK    141 - 210
SASCGMIMVILLLLVAIVVVAVWPTN                                                211 - 236
//

Text Mined References (28)

PMID Year Title
27094127 2016 Syntaxin 8 is required for efficient lytic granule trafficking in cytotoxic T lymphocytes.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25523146 2015 Expression of syntaxin 8 in visceral adipose tissue is increased in obese patients with type 2 diabetes and related to markers of insulin resistance and inflammation.
25416956 2014 A proteome-scale map of the human interactome network.
25404741 2015 Syntaxin 8 regulates platelet dense granule secretion, aggregation, and thrombus stability.
24743596 2014 Cooperative endocytosis of the endosomal SNARE protein syntaxin-8 and the potassium channel TASK-1.
24659781 2014 Tight junctional localization of claudin-16 is regulated by syntaxin 8 in renal tubular epithelial cells.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20886065 2010 Molecular reclassification of Crohn's disease by cluster analysis of genetic variants.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19422935 2009 Genetic risk profiling and prediction of disease course in Crohn's disease patients.
19174780 2009 Confirmation of multiple Crohn's disease susceptibility loci in a large Dutch-Belgian cohort.
18980942 2009 Differential palmitoylation of the endosomal SNAREs syntaxin 7 and syntaxin 8.
18570918 2008 Endosomal SNARE proteins regulate CFTR activity and trafficking in epithelial cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17965969 2008 Syntaxin 8 has two functionally distinct di-leucine-based motifs.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15039462 2004 Syntaxin 8 impairs trafficking of cystic fibrosis transmembrane conductance regulator (CFTR) and inhibits its channel activity.
14991845 2004 Elevated expression of a regulator of the G2/M phase of the cell cycle, neuronal CIP-1-associated regulator of cyclin B, in Alzheimer's disease.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12175335 2002 Syntaxin 7, syntaxin 8, Vti1 and VAMP7 (vesicle-associated membrane protein 7) form an active SNARE complex for early macropinocytic compartment fusion in Dictyostelium discoideum.
10839363 2000 SNAREs contribute to the specificity of membrane fusion.
10781590 2000 Identification of CIP-1-associated regulator of cyclin B (CARB), a novel p21-binding protein acting in the G2 phase of the cell cycle.
10564279 1999 Differential roles of syntaxin 7 and syntaxin 8 in endosomal trafficking.
10198254 1999 Molecular cloning, expression analysis, and chromosomal localization of human syntaxin 8 (STX8).
9852078 1998 Three novel proteins of the syntaxin/SNAP-25 family.