Property Summary

NCBI Gene PubMed Count 48
PubMed Score 53.12
PubTator Score 44.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis 1.200 1.9e-03
osteosarcoma -1.170 3.5e-04
tuberculosis and treatment for 6 months -1.300 4.8e-04
non-small cell lung cancer 1.062 3.4e-14
Breast cancer 3.000 2.2e-02
group 4 medulloblastoma 1.400 3.3e-04
breast carcinoma 1.100 4.0e-26
ductal carcinoma in situ 1.400 8.2e-04
invasive ductal carcinoma 1.600 7.0e-03
ovarian cancer 1.500 3.6e-03

Gene RIF (17)

PMID Text
26906622 the expression of STX6 was up-regulated in esophageal squamous cell carcinoma samples, and its expression was significantly correlated with tumor size, histological differentiation, lymph node metastasis and depth
25496667 Genome-wide shRNA screening identifies STX6, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
24746815 The compartment-specific interaction of Syntaxin 6 with v-SNARES VAMP3 and VAMP4 are controlled through an ability of Syntaxin 6 to sense cholesterol levels in the trans-Golgi network and recycling endosomes.
23932592 A dityrosine motif of Ang2 interacts with a highly conserved groove in Syntaxin 6.
23818989 Data indicate that E3 ubiquitin ligase MARCH2 co-immunoprecipitated and co-localized with CAL and syntaxin 6 (STX6), and show the ubiquitination of CFTR by MARCH2.
23798538 Syntaxin 6 and VAMP4 colocalize to the chlamydial inclusion.
23677696 Data indicate that depletion of VAMP4, syntaxin 6, syntaxin 16, and Vti1a disrupted the Golgi ribbon structure.
23585472 colocalization of ATP11B with fluorescent cisplatin and with vesicular trafficking proteins, such as STX6 and VAMP4, strongly suggests that ATP11B contributes to secretory vesicular transport of cisplatin from Golgi to plasma membrane
23415606 No pathogenic mutations are found in syntaxin 6 that are associated with risk of Parkinson's disease.
22573826 Data suggest a new integrin trafficking pathway in which endocytosed integrins are transported from VAMP3-containing recycling endosomes to STX6-containing trans-Golgi network before being recycled to the plasma membrane.
22489884 A review of the various roles of the Golgi- and endosome-localized t-SNARE, syntaxin-6, in membrane trafficking during physiological as well as pathological conditions. [Review]
21880737 syntaxin 6-regulated membrane trafficking events control outside-in signaling via haptotactic and chemotactic mechanisms.
21807881 COG directly and positively regulates endosome-to-TGN retrograde transport by specific and direct interaction with the t-SNARE Stx6 via its Cog6 subunit.
21109560 The trans-Golgi SNARE protein syntaxin 6 is recruited to the chlamydial inclusion in a manner that requires chlamydial protein synthesis and is conserved among all chlamydial species examined.
21063020 Importance of syntaxin 6 in the maintenance of cellular VEGFR2 levels.The inhibitory form of syntaxin 6 has good potential as an antiangiogenic agent.
20130090 Syntaxin 6 and CAL mediate the degradation of the cystic fibrosis transmembrane conductance regulator
18779328 STX6 can be induced by DNA damage and Mdm2 inhibitor Nutlin-3 in a p53-dependent manner.

AA Sequence

MSMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDLEDLDETISI      1 - 70
VEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMSTSSVQALAERKNRQALLGDSGSQNWSTGTTDKY     71 - 140
GRLDRELQRANSHFIEEQQAQQQLIVEQQDEQLELVSGSIGVLKNMSQRIGGELEEQAVMLEDFSHELES    141 - 210
TQSRLDNVMKKLAKVSHMTSDRRQWCAIAILFAVLLVVLILFLVL                             211 - 255
//

Text Mined References (53)

PMID Year Title
26906622 2016 Essential role of STX6 in esophageal squamous cell carcinoma growth and migration.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25799061 2015 EARP is a multisubunit tethering complex involved in endocytic recycling.
25416956 2014 A proteome-scale map of the human interactome network.
24746815 2014 Cholesterol regulates Syntaxin 6 trafficking at trans-Golgi network endosomal boundaries.
23932592 2013 Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6.
23818989 2013 Ubiquitination and degradation of CFTR by the E3 ubiquitin ligase MARCH2 through its association with adaptor proteins CAL and STX6.
23798538 2013 Vesicle-associated membrane protein 4 and syntaxin 6 interactions at the chlamydial inclusion.
23677696 2013 VAMP4 is required to maintain the ribbon structure of the Golgi apparatus.
23585472 2013 ATP11B mediates platinum resistance in ovarian cancer.
23415606 2013 STX6 rs1411478 is not associated with increased risk of Parkinson's disease.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22573826 2012 Regulation of integrin endocytic recycling and chemotactic cell migration by syntaxin 6 and VAMP3 interaction.
22489884 2012 Regulation of intracellular membrane trafficking and cell dynamics by syntaxin-6.
21880737 2011 Endothelial cell migration on fibronectin is regulated by syntaxin 6-mediated alpha5beta1 integrin recycling.
21807881 2011 The COG complex interacts directly with Syntaxin 6 and positively regulates endosome-to-TGN retrograde transport.
21685912 2011 Identification of common variants influencing risk of the tauopathy progressive supranuclear palsy.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21109560 2011 The trans-Golgi SNARE syntaxin 6 is recruited to the chlamydial inclusion membrane.
21063020 2011 Regulation of vascular endothelial growth factor receptor 2 trafficking and angiogenesis by Golgi localized t-SNARE syntaxin 6.
20685960 2010 Ang2/fat-free is a conserved subunit of the Golgi-associated retrograde protein complex.
20130090 2010 Syntaxin 6 and CAL mediate the degradation of the cystic fibrosis transmembrane conductance regulator.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19620288 2009 Dual roles of the mammalian GARP complex in tethering and SNARE complex assembly at the trans-golgi network.
19224922 2009 Differential effects of depletion of ARL1 and ARFRP1 on membrane trafficking between the trans-Golgi network and endosomes.
18779328 2008 Syntaxin 6, a regulator of the protein trafficking machinery and a target of the p53 family, is required for cell adhesion and survival.
17159904 2007 Early endosomal SNAREs form a structurally conserved SNARE complex and fuse liposomes with multiple topologies.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16154903 Trans-Golgi network syntaxin 10 functions distinctly from syntaxins 6 and 16.
15689499 2005 MARCH-II is a syntaxin-6-binding protein involved in endosomal trafficking.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15322554 2004 Control of vesicle fusion by a tyrosine phosphatase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14623309 2003 Identification of mouse Vps16 and biochemical characterization of mammalian class C Vps complex.
12853575 2003 A dual mechanism controlling the localization and function of exocytic v-SNAREs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11839770 2002 Early/recycling endosomes-to-TGN transport involves two SNARE complexes and a Rab6 isoform.
11707463 2002 A Golgi-associated PDZ domain protein modulates cystic fibrosis transmembrane regulator plasma membrane expression.
11423532 2001 Association of insulin-like growth factor 1 receptor with EHD1 and SNAP29.
11384996 2001 Association of a novel PDZ domain-containing peripheral Golgi protein with the Q-SNARE (Q-soluble N-ethylmaleimide-sensitive fusion protein (NSF) attachment protein receptor) protein syntaxin 6.
11278762 2001 Syntaxin 7 complexes with mouse Vps10p tail interactor 1b, syntaxin 6, vesicle-associated membrane protein (VAMP)8, and VAMP7 in b16 melanoma cells.
11001914 2000 Involvement of SNAP-23 and syntaxin 6 in human neutrophil exocytosis.
10839363 2000 SNAREs contribute to the specificity of membrane fusion.
10506127 1999 The Rab5 effector EEA1 interacts directly with syntaxin-6.
10359608 1999 Vesicle-associated membrane protein 4 is implicated in trans-Golgi network vesicle trafficking.
10080545 1999 Co-expression of several human syntaxin genes in neutrophils and differentiating HL-60 cells: variant isoforms and detection of syntaxin 1.
9880331 1999 GS32, a novel Golgi SNARE of 32 kDa, interacts preferentially with syntaxin 6.
9697774 1998 EEA1 links PI(3)K function to Rab5 regulation of endosome fusion.
9110174 1997 Large-scale concatenation cDNA sequencing.
8663448 1996 A new syntaxin family member implicated in targeting of intracellular transport vesicles.
8619474 1996 A "double adaptor" method for improved shotgun library construction.