Property Summary

NCBI Gene PubMed Count 32
PubMed Score 51.05
PubTator Score 22.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma -1.200 4.7e-02
ependymoma -1.500 2.8e-02
osteosarcoma -1.182 1.9e-05
atypical teratoid / rhabdoid tumor -1.700 1.3e-06
glioblastoma -1.500 5.6e-04
medulloblastoma, large-cell -1.600 1.4e-04
juvenile dermatomyositis 1.826 7.7e-13
acute quadriplegic myopathy 1.070 8.7e-06
primary pancreatic ductal adenocarcinoma 1.022 4.1e-03
intraductal papillary-mucinous adenoma (... 1.700 4.7e-03
intraductal papillary-mucinous carcinoma... 1.800 5.1e-03
intraductal papillary-mucinous neoplasm ... 1.700 4.6e-02
cystic fibrosis -1.300 1.1e-03
pediatric high grade glioma -1.200 1.2e-03
spina bifida -2.226 2.0e-02
progressive supranuclear palsy -1.100 3.6e-02
gastric carcinoma 1.100 2.9e-02
ovarian cancer -1.500 3.1e-05
pancreatic cancer 1.200 1.5e-03

Gene RIF (11)

PMID Text
25501894 the "multimodulator" scaffold roles of striatins in the initiation and regulation of the formation of various complex particles and structures, are discussed.
25497017 PP2A/striatin complex modulates microtubule dynamics by regulating MAP2 phosphorylation
25368024 the rapid, nongenomic mineralocorticoid receptor pathway (mediated via striatin) has a role in modulating the interaction between salt intake and blood pressure.
24613930 Our data demonstrate that STRN-ALK fusion occurs in a subset of patients with highly aggressive types of thyroid cancer and provide initial evidence suggesting that it may represent a therapeutic target for these patients.
24475247 A recurrent STRN/ALK fusion found in thyroid carcinomas.
21985334 Striatin orchestrates the regulation of Mst3 by PP2A.
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
19023099 Observational study of gene-disease association. (HuGE Navigator)
18571342 Taken together, splicing variation of SG2NA might have some critical roles in differentiation and maturation in metazoan cells.
17975119 Observational study of gene-disease association. (HuGE Navigator)
15569929 identify striatin as a molecular scaffold required for rapid, nongenomic estrogen-mediated activation of downstream signaling pathways

AA Sequence

MDEQAGPGVFFSNNHPGAGGAKGLGPLAEAAAAGDGAAAAGAARAQYSLPGILHFLQHEWARFEVERAQW      1 - 70
EVERAELQAQIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAKYHKLKYGTELNQGDMKPPSYDSDEG     71 - 140
NETEVQPQQNSQLMWKQGRQLLRQYLQEVGYTDTILDVKSKRVRALLGFSSDVTDREDDKNQDSVVNGTE    141 - 210
AEVKETAMIAKSELTDSASVLDNFKFLESAAADFSDEDEDDDVDGREKSVIDTSTIVRKKALPDSGEDRD    211 - 280
TKEALKEFDFLVTSEEGDNESRSAGDGTDWEKEDQCLMPEAWNVDQGVITKLKEQYKKERKGKKGVKRPN    281 - 350
RSKLQDMLANLRDVDELPSLQPSVGSPSRPSSSRLPEHEINRADEVEALTFPPSSGKSFIMGADEALESE    351 - 420
LGLGELAGLTVANEADSLTYDIANNKDALRKTWNPKFTLRSHFDGIRALAFHPIEPVLITASEDHTLKMW    421 - 490
NLQKTAPAKKSTSLDVEPIYTFRAHKGPVLCVVMSSNGEQCYSGGTDGLIQGWNTTNPNIDPYDSYDPSV    491 - 560
LRGPLLGHTDAVWGLAYSAAHQRLLSCSADGTLRLWNTTEVAPALSVFNDTKELGIPASVDLVSSDPSHM    561 - 630
VASFSKGYTSIFNMETQQRILTLESNVDTTANSSCQINRVISHPTLPISITAHEDRHIKFYDNNTGKLIH    631 - 700
SMVAHLEAVTSLAVDPNGLYLMSGSHDCSIRLWNLESKTCIQEFTAHRKKFEESIHDVAFHPSKCYIASA    701 - 770
GADALAKVFV                                                                771 - 780
//

Text Mined References (40)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25501894 2015 Striatins as plaque molecules of zonulae adhaerentes in simple epithelia, of tessellate junctions in stratified epithelia, of cardiac composite junctions and of various size classes of lateral adherens junctions in cultures of epithelia- and carcinoma-derived cells.
25497017 2015 Downregulation of striatin leads to hyperphosphorylation of MAP2, induces depolymerization of microtubules and inhibits proliferation of HEK293T cells.
25416956 2014 A proteome-scale map of the human interactome network.
25368024 2015 Variants in striatin gene are associated with salt-sensitive blood pressure in mice and humans.
24613930 2014 Identification of the transforming STRN-ALK fusion as a potential therapeutic target in the aggressive forms of thyroid cancer.
24475247 2014 Identification of a recurrent STRN/ALK fusion in thyroid carcinomas.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22153077 2011 Structural basis and sequence rules for substrate recognition by Tankyrase explain the basis for cherubism disease.
21985334 2011 Protein phosphatase 2a (PP2A) binds within the oligomerization domain of striatin and regulates the phosphorylation and activation of the mammalian Ste20-Like kinase Mst3.
21269460 2011 Initial characterization of the human central proteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
18782753 2009 A PP2A phosphatase high density interaction network identifies a novel striatin-interacting phosphatase and kinase complex linked to the cerebral cavernous malformation 3 (CCM3) protein.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18571342 2008 WD-40 repeat protein SG2NA has multiple splice variants with tissue restricted and growth responsive properties.
18502210 2008 The armadillo repeat domain of the APC tumor suppressor protein interacts with Striatin family members.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
17540176 2007 The tumor suppressor PP2A Abeta regulates the RalA GTPase.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15569929 2004 Striatin assembles a membrane signaling complex necessary for rapid, nongenomic activation of endothelial NO synthase by estrogen receptor alpha.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12153137 2001 A novel human hydroxysteroid dehydrogenase like 1 gene (HSDL1) is highly expressed in reproductive tissues.
11707266 2001 Striatin, a calmodulin-dependent scaffolding protein, directly binds caveolin-1.
10748158 2000 Zinedin, SG2NA, and striatin are calmodulin-binding, WD repeat proteins principally expressed in the brain.
10681496 2000 WD40 repeat proteins striatin and S/G(2) nuclear autoantigen are members of a novel family of calmodulin-binding proteins that associate with protein phosphatase 2A.
9693043 1998 Cloning of human striatin cDNA (STRN), gene mapping to 2p22-p21, and preferential expression in brain.
8769426 1996 A novel calmodulin-binding protein, belonging to the WD-repeat family, is localized in dendrites of a subset of CNS neurons.