Property Summary

NCBI Gene PubMed Count 37
PubMed Score 89.98
PubTator Score 59.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
malignant mesothelioma 2.300 3.5e-07
astrocytoma -5.500 1.1e-03
posterior fossa group B ependymoma -6.700 1.6e-14
oligodendroglioma -2.700 1.9e-02
cutaneous lupus erythematosus 1.600 1.1e-02
psoriasis -1.600 8.0e-03
glioblastoma -4.700 1.5e-02
atypical teratoid / rhabdoid tumor -6.000 3.2e-06
medulloblastoma, large-cell -1.100 2.8e-04
Crohn's disease -1.223 8.4e-04
intraductal papillary-mucinous adenoma (... -2.200 1.2e-03
intraductal papillary-mucinous carcinoma... -2.100 3.0e-03
colon cancer -3.300 2.3e-06
adult high grade glioma -4.200 3.3e-06
pilocytic astrocytoma -5.400 6.8e-10
Breast cancer -1.300 5.0e-02
lung carcinoma 1.400 8.2e-10
Pick disease -2.300 1.5e-02
pituitary cancer 3.400 3.1e-05
Down syndrome -1.400 2.1e-02

Gene RIF (14)

PMID Text
24589734 STMN and SCG10 are similarly targeted by JNK but there are clear differences in JNK recognition and phosphorylation of the closely related family member, SCLIP.
24414001 RARB and STMN2 polymorphisms were not associated with sporadic CJD in the Korean population.
23893240 PAK4-SCG10 signaling occurs in gastric cancer cell invasion.
21273291 SCG10 is upregulated in the IKAP/Elp1-deficient familial dysautonomia cerebrum lending support to the concept that SCG10 elevation can alter the microtubule organization and dynamics
21215777 CaMy1 via SCG10 couples Ca(2+) signals with the dynamics of microtubules during neuronal outgrowth in the developing brain.
20802173 Overexpression of SCG10 is associated with Liver Fibrosis.
18996843 SCG10 acts as an effector downstream of Rnd1 to regulate axon extensions by modulating microtubule organization.
18611392 STMN2 appears a novel marker of osteogenesis and osteoblast per se, that could play a role in the regulation of the adipocyte/osteoblast balance.
18549247 SCLIP and SCG10 were colocalized to the Golgi apparatus of chromaffin cells in vivo and shared localization with CHGA as it transited the Golgi.
18452648 BRI3 associates with SCG10 and attenuates NGF-induced neurite outgrowth in PC12 cells.
18076368 Review proposes a model reconciling the microtubule regulatory properties of superior cervical ganglion protein 10 with its role as a c-Jun N-terminal kinase 1 (JNK1) effector of regeneration.
17311410 activity at opposite microtubule ends may play role role in regulating growth cone microtubules; ability to promote plus end growth may facilitate microtubule extension; ability to destabilize minus ends may provide tubulin for net plus end elongation
16712787 STMN2 is required for maintaining the anchorage-independent growth state of beta-catenin/TCF-activated hepatoma cells
12140291 RGS6 interacts with this protein and promotes neuronal differentiation; role of the G gamma subunit-like (GGL) domain of RGS6

AA Sequence

MAKTAMAYKEKMKELSMLSLICSCFYPEPRNINIYTYDDMEVKQINKRASGQAFELILKPPSPISEAPRT      1 - 70
LASPKKKDLSLEEIQKKLEAAEERRKSQEAQVLKQLAEKREHEREVLQKALEENNNFSKMAEEKLILKME     71 - 140
QIKENREANLAAIIERLQEKERHAAEVRRNKELQVELSG                                   141 - 179
//

Text Mined References (41)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24589734 2014 Differences in c-Jun N-terminal kinase recognition and phosphorylation of closely related stathmin-family members.
24414001 2014 RARB and STMN2 polymorphisms are not associated with sporadic Creutzfeldt-Jakob disease (CJD) in the Korean population.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23893240 2014 PAK4 kinase-mediated SCG10 phosphorylation involved in gastric cancer metastasis.
21471001 2011 Subcellular Golgi localization of stathmin family proteins is promoted by a specific set of DHHC palmitoyl transferases.
21273291 2011 IKAP/Elp1 involvement in cytoskeleton regulation and implication for familial dysautonomia.
21215777 2011 Calmyrin1 binds to SCG10 protein (stathmin2) to modulate neurite outgrowth.
20883670 2010 Cord blood administration induces oligodendrocyte survival through alterations in gene expression.
20802173 2010 SCG10 expression on activation of hepatic stellate cells promotes cell motility through interference with microtubules.
20621975 2010 KBP interacts with SCG10, linking Goldberg-Shprintzen syndrome to microtubule dynamics and neuronal differentiation.
19959466 2010 Regulation of neurite outgrowth by interactions between the scaffolding protein, JNK-associated leucine zipper protein, and neuronal growth-associated protein superior cervical ganglia clone 10.
19081515 2009 Genetic risk factors for variant Creutzfeldt-Jakob disease: a genome-wide association study.
18996843 2009 Rnd1 regulates axon extension by enhancing the microtubule destabilizing activity of SCG10.
18611392 2008 Stathmin-like 2, a developmentally-associated neuronal marker, is expressed and modulated during osteogenesis of human mesenchymal stem cells.
18570921 2008 NRSF silencing induces neuronal differentiation of human mesenchymal stem cells.
18549247 2008 The trans-Golgi proteins SCLIP and SCG10 interact with chromogranin A to regulate neuroendocrine secretion.
18452648 2008 BRI3 associates with SCG10 and attenuates NGF-induced neurite outgrowth in PC12 cells.
18076368 2008 Superior cervical ganglion-10 protein as a molecular effector of c-Jun N-terminal kinase 1: implications for the therapeutic targeting of Jun N-terminal kinase in nerve regeneration.
17311410 2007 Stathmin family protein SCG10 differentially regulates the plus and minus end dynamics of microtubules at steady state in vitro: implications for its role in neurite outgrowth.
16712787 2006 STMN2 is a novel target of beta-catenin/TCF-mediated transcription in human hepatoma cells.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15561718 2005 Systematic identification and analysis of mammalian small ubiquitin-like modifier substrates.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15200951 2004 Localized domains of G9a-mediated histone methylation are required for silencing of neuronal genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12858178 2003 TRPC5 is a regulator of hippocampal neurite length and growth cone morphology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12140291 2002 RGS6 interacts with SCG10 and promotes neuronal differentiation. Role of the G gamma subunit-like (GGL) domain of RGS6.
11882662 2002 The interaction of RGSZ1 with SCG10 attenuates the ability of SCG10 to promote microtubule disassembly.
11830198 2002 Neuronal target genes of the neuron-restrictive silencer factor in neurospheres derived from fetuses with Down's syndrome: a gene expression study.
11718727 2001 c-Jun N-terminal kinase-3 (JNK3)/stress-activated protein kinase-beta (SAPKbeta) binds and phosphorylates the neuronal microtubule regulator SCG10.
11278715 2001 Stathmin family proteins display specific molecular and tubulin binding properties.
10947801 2000 Localization and targeting of SCG10 to the trans-Golgi apparatus and growth cone vesicles.
9525956 1998 Identification of in vitro phosphorylation sites in the growth cone protein SCG10. Effect Of phosphorylation site mutants on microtubule-destabilizing activity.
9126608 1997 Purification, characterization, and in vitro phosphorylation of the neuron-specific membrane-associated protein SCG10.
9030585 1997 Targeting of SCG10 to the area of the Golgi complex is mediated by its NH2-terminal region.
8622778 SCG10, a neuron-specific growth-associated protein in Alzheimer's disease.
7871435 1995 The neuron-restrictive silencer factor (NRSF): a coordinate repressor of multiple neuron-specific genes.