Property Summary

NCBI Gene PubMed Count 334
PubMed Score 899.74
PubTator Score 708.57

Knowledge Summary

Patent (22,201)

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.300 1.0e-04
osteosarcoma -3.699 2.2e-09
diabetes mellitus -1.200 1.5e-03
non primary Sjogren syndrome sicca 1.100 1.4e-02
ovarian cancer 1.100 7.9e-04

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (309)

PMID Text
27060312 Mutations of the STK11 gene are the major cause of Peutz-Jeghers syndrome.
27035914 results suggest that decreased LKB1 expression in patients with solid tumors might be related to poor prognosis and serve as a potential predictive marker of poor clinicopathological prognostic factors
26976973 Results show the expression of LKB1 mRNA and protein lower in gastric-cancer cell lines and tumor tissues compared to normal gastric cells correlated with poor prognosis with a lower survival rate.
26833127 STK11/LKB1-inactivating mutations were associated with reduced expression of PD-1 ligand PD-L1 in mouse and patient tumors as well as in tumor-derived cell lines.
26662608 we present two elderly patients with thyroid carcinoma harboring STK11 mutation without clinical manifestation of Peutz-Jeghers syndrome. The findings suggest that STK11 may play a role in thyroid carcinoma development.
26616116 The present study aimed to compare the expression of liver kinase B1 (LKB1) in prostate cancer (PCa) tissues and the paired adjacent tissues, then to evaluate the statistical relationship between LKB1 expression and prognosis of PCa patients.
26607058 We found seven novel and four recurrent STK11 gene mutations in Chinese children with PJS.
26549522 the expression of LKB1 was reduced in the gastric cancer tissues
26517522 Data show that integrin beta3 and serine/threonine-protein kinase LKB1 are involved in the inhibition of proliferation by lovastatin independently.
26479318 Studies indicate link between the 6-phosphogluconate dehydrogenase, oxidative pentose phosphate pathway (PPP) and lipogenesis through Ru-5-P-dependent inhibition of serine/threonine protein kinase LKB1-AMPK signalling.
26470595 Deoxypodophyllotoxin suppresses gastric tumor vasculature by promoting cytoskeleton remodeling through LKB1-AMPK dependent Rho A activation.
26458553 Transfection with eukaryotic plasmid for the simultaneous expression of GRIM19 and LKB1 more effectively suppressed the growth of breast cancer in vitro and in vivo, and may therefore have therapeutic potential for the treatment of human breast cancer.
26413869 In human primary endometrial cancers, loss of LKB1 protein was strongly associated with increased CCL2 expression by tumor cells as well as increased macrophage density in the tumor microenvironment.
26398719 This review focuses on the function of the LKB1/AMPK pathway in the invasion and migration of cancer cells and provides an overview of therapeutic strategies aimed at this pathway in malignant tumors.
26386697 This report details the first four reported cases of somatic mosaicism for STK11 associated with Peutz-Jeghers syndrome
26359358 Data show that honokiol (HNK) increases microRNA miR-34a in liver kinase B1 (LKB1)-dependent manner.
26345094 rs8111699 polymorphism of STK11 has no role in the development of gestational diabetes in pregnant Saudi women
26212320 The LKB1 K178R SUMO mutant had defective AMPK signaling and mitochondrial function, inducing death in energy-deprived cells.
26147831 This is the fi rst report of clinical overlap in individuals with PCOS and PJS, even though some individuals with PCOS show a polymorphism in STK11.
26068970 Results demonstrate a direct impact of altered LKB1-AMPK signalling function in EOC. In addition, this is the first evidence in cancer cells demonstrating a pro-survival function for LKB1, a kinase traditionally thought to act as a tumour suppressor.
26056085 Findings suggest a novel mechanism for ICC carcinogenesis in which LKB1 underexpression enhances multiple signaling pathways including Wnt/beta-catenin to promote disease progression.
26027660 LKB1 gene inactivation in non-small cell lung cancer cells does not increase the sensitivity to the mTOR inhibitors.
25894929 Disruption of BASIGIN decreases lactic acid export and sensitizes non-small cell lung cancer to biguanides independently of the LKB1 status.
25874865 MLK3 serves as a common upstream kinase of AMPK and JNK and functions as a direct upstream kinase for AMPK independent of LKB1
25874445 Our data suggest that beta cells lacking LKB1 could be used as a system to identify additional molecular events that connect metabolism to cellular excitation in the insulin secretion pathway
25850957 Significant downregulation of LKB1 and PTEN mRNA expression levels were detected in tumour tissues compared to non-cancerous tissues.
25841653 Specific Alu elements involved in a significant percentage of copy number variations of the STK11 gene in patients with Peutz-Jeghers syndrome.
25798842 LKB1 loss early in ovarian serous tumorigenesis has an integral role in tumor promotion by disrupting apical to basal polarity in the presence of mutated p53 in fallopian tube cells.
25769882 The presence of LKB1 may facilitate increases in either MDR1 or class III beta-tubulin expression.
25751324 Case Report: detection of encapsulated follicular variant of papillary thyroid carcinoma with heterozygous germline STK11 mutation.
25737507 LKB1 IHC is a reliable and efficient assay to evaluate for loss of LKB1 in clinical samples of NSCLC.
25728766 LKB1 ubiquitination is critical for maintaining its activity and complex integrity.Overexpression of LKB1 and Skp2 is found in hepatocellular carcinoma patients and predicts poor survival outcomes.
25695224 STK11 mutations were associated with stage IV lung adenocarcinoma adrenal metastases.
25694554 This study demonstrate that an SNP in intron 5 of the STK11 gene shows a significant association in women with MS and therefore can be considered a genetic risk factor in a similar manner as SNPs identified by GWAS analyses.
25674212 Our results suggest that LKB1 may inhibit tumorigenesis by regulating the Hh signaling pathway in certain cancers
25650664 Data show that serine/threonine kinase LKB1 and proto-oncogene protein Akt are targets of neddylation, suggesting the post-translational modification (PTM) as a potential therapeutic target during liver tumor management and treatment.
25510663 Through its interference with the LKB1-p53-p21/WAF1 pathway expression.
25465874 We also identified a positive feedback LKB1/CRTC1 signaling loop for COX-2/PGE2 regulation. Data suggest a role for LKB1 status and glycosylated COX-2 as specific biomarkers that provide a framework for selecting patients for COX-2 inhibition studies.
25399650 Probucol suppresses human glioma cell proliferation in vitro via ROS production and LKB1-AMPK activation, which reduces 26S proteasome-dependent degradation of p27(Kip1).
25362209 The LKB1/AMPK pathway is involved in diabetic cardiomyopathy and lipotoxicity in cardiac myocytes.
25349262 LKB1 functions as a directional migration sensor of gradients of extracellular matrix (haptotaxis) but not soluble growth factor cues (chemotaxis).
25329316 LKB1 mediates CDKN1A degradation in response to ultraviolet DNA damage.
25263448 Data indicate that integrity of the p38 MAPK signaling is necessary for the antioxidant function of liver kinase B1 (LKB1).
25244018 LKB1 is mutated in many cancers. The expression of LKB1 can be regulated through epigenetic modification, transcriptional regulation and post-translational modification. Review.
25224251 LKB1 CN in combination with KRAS mutation predicted brain metastasis in NSCLC.
25180605 LKB1 promotes RAB7-mediated neuropilin-1 degradation to inhibit angiogenesis
25179843 Our results indicate that the LKB1 gene is frequently altered in RCC and may play a role in RCC progression.
25178656 Loss of LKB1 disrupts breast epithelial cell polarity and promotes breast cancer metastasis and invasion.
25175672 Study demonstrated that expression of LKB1 and Beclin1 was reduced in non-small cell lung cancer (NSCLC) tissues, and the reduced expression of these proteins, is an independent indicator for the overall survival of NSCLC patients.
25155037 LKB1 was a target gene of miR-155, suggesting that miRNA-155 promoted the proliferation of cervical cancer cells by regulating LKB1 expression.
25122068 The knockdown of PDE4D gene expression inhibited proliferation of STK11-mutated lung cancer lines. Furthermore, challenge with a panel of PDE4-specific inhibitors was shown to selectively reduce the growth of STK11-mutated lung cancer lines.
25114112 These results suggest that the formation of STK11-dependent lateral cell-cell contacts competent for tyrosine kinase signaling promotes S. flexneri dissemination in epithelial cells.
25042806 Results show the ability of LKB1 to suppress Snail1 levels was independent of AMPK but required the related kinases MARK1 and MARK4.
25042259 The loss of wild-type p53 in high-grade endometrioid endometrial cancer (EEC) may contribute to the LKB1 loss observed in these more aggressive tumors.
25011082 Endoplasmic reticulum stress activators represent a potential treatment avenue for non-small cell lung cancers deficient in LKB1.
24998845 Results show that DeltaN-LKB1 is a novel LKB1 isoform with a dual role LKB1 function with a dominant-negative effect on the LKB1 polarizing activity and oncogenic properties accounting for some of the paradoxical effects of LKB1 during tumorigenesis.
24928005 Missense mutation F354L of STK11 gene is associated with the Peutz-Jeghers syndrome.
24913037 LKB1 is differentially regulated by PRL at the level of transcription in representative human breast cancer cells. Its promoter is targeted by STAT3 and STAT5A, and the cellular estrogen receptor status may affect PRL-responsiveness
24828662 Loss of LKB1 defines a subset of lung adenocarcinomas associated with characteristic molecular phenotypes and distinctive gene expression features.
24793789 MZF1-mediated MYC expression may promote tumor progression, resulting in poor outcomes in cases of lung adenocarcinoma with low-wild-type-LKB1 tumors.
24792998 This study establishes LKB1 as an important tumor suppressor in cervical cancer and sheds light on a novel signaling pathway regulated by LKB1
24770722 findings indicated that genetic variations of the LKB1-AMPK-TSC1/2 axis may influence prognosis for colorectal cancer; 3 SNPs (STK11 rs741765, PRKAA1 rs461404 and TSC1 rs13295634) were significantly associated with disease-free survival or overall survival
24722282 A novel function of LKB1 in the maintenance of genomic stability through the regulation of centrosome mediated by PLK1, is reported.
24676538 downregulation of LKB1 expression suppresses Stat3 activity that may promote tumor growth during esophageal cancer progression.
24652667 our results in a large cohort of Chinese PJS patients identified an overrepresentation of mutations within STK11's kinase domain XI and demonstrated that these mutations were strongly associated with the development of dysplastic GI polyps.
24647869 Study concludes that suppression of lung cancer cell invasion by LKB1 through downregulation of TF and VEGF may partly depend on its inhibitory effect on the transcription factor Sp1.
24645967 Preliminary data suggest that, at least in a subgroup of patients, changes related to accelerated aging with special involvement of the LKB1/AMPK axis could be implicated in the pathophysiology of fibromyalgia
24615515 Results highlight that LKB1 expression in breast cancer appears to have opposite effects depending on its subcellular localization.
24604241 STK11 variant mutations underlie Peutz-Jeghers syndrome in Chinese patients
24550282 The tumor suppressor LKB1 is a central regulator of tumor metabolism and growth control through the regulation of HIF-1alpha-dependent metabolic reprogramming.
24469340 LKB1 activated LKB1/AMPK signaling and arrested the cell cycle at the G1 phase in an LKB1-dependent manner. G1 arrest induced by LKB1 was accompanied by the downregulation of cyclin D1 and cyclin D3, and the upregulation of p53, p21 and p16.
24468202 mutations may confer resistance to epidermal growth factor receptor-tyrosine kinase inhibitors in lung adenocarcinoma patients
24419424 Mutation of LKB1 is associated with lung adenocarcinoma.
24387336 Within this review, several agents with potential activity against aberrant LKB1 signaling have been discussed. Potential strategies and challenges in targeting LKB1 inactivation are also considered
24362629 identification of a signalling axis that links YAP activation with LKB1 mutations, and implications for the treatment of LKB1-mutant human malignancies; in addition, findings provide insight into upstream signals of the Hippo-YAP signalling cascade
24285539 LKB1 expression in cancer cell resulted in dephosphorylation of several tumor-enhancing RTKs, including ErbB2, hepatocyte growth factor receptor (c-Met), EphA2, rearranged during transfection (RET), and insulin-like growth factor I receptor.
24170201 results implicate LKB1 loss in the OSE in the pathogenesis of serous ovarian cancer and provide a compelling rationale for investigating the therapeutic potential of targeting LKB1 signaling in patients with this deadly disease
24154639 Two new germline variants are identified in Peutz-Jeghers syndrome
24146957 The tumor suppressor gene TUSC2 (FUS1) sensitizes NSCLC to the AKT inhibitor MK2206 in LKB1-dependent manner.
24086281 This assay should be broadly useful for research studies employing mouse models and also for the development of human tissue-based assays for LKB1 in diverse clinical settings
24074562 These results suggest that LKB1 may be a cell-type specific tumor suppressor.
24037887 Data suggest that loss of heterozygosity in STK11 results in increases in aromatase expression and nuclear localization of CRTCs (CREB regulated transcription coactivators); thus, estrogen synthesis is upregulated in testis and breast. [CASE STUDIES]
24022664 the interaction between LKB1 and GSK3b upregulates GSK3b activity to suppress WNT-induced cell proliferation in esophageal carcinoma cells
23995788 losses of LKB1 at the transcriptional level by altered activity of the NKX2-1/p53 pathway may promote tumor malignancy and poor patient outcome.
23892522 Mutation of the LKB1 gene is a cause of Peutz-Jeghers syndrome. There is a spectrum of the STK11 gene mutations.
23883619 LKB1 is required for chondrocyte AMPK activity, thereby inhibiting matrix catabolic responses to inflammatory cytokines
23878245 Data indicate a nitrosative-stress signaling pathway that engages ATM, LKB1, AMPK and TSC2 tumor suppressors to repress mTORC1 and regulate autophagy.
23861764 LKB1 may inhibit tumorigenesis by regulating hedgehog signaling in certain cancers.
23810581 Downregulation of LKB1 is independent of FOXO3 and may be implicated in the progression of head and neck squamous cell carcinoma.
23706335 In pregnant women, the G allele for the rs8111699 variant in STK11 is associated with a more favorable metabolic phenotype and may protect against the development of gestational diabetes, particularly in heavier women.
23679304 Decreased expression of LKB1 correlates with hepatocellular carcinoma.
23664447 LKB1 LOH was more frequent in males, smokers, and tumors with a TP53 mutation than in females.
23648482 LKB1 and p114RhoGEF control RhoA activity in bronchial epithelial cells to promote apical junction assembly.
23645358 Clonality analysis suggests that STK11 gene mutations are involved in progression of lobular endocervical glandular hyperplasia to minimal deviation adenocarcinoma.
23637231 LKB1 serves as a FAK repressor to stabilize focal adhesion sites.
23612973 similar to Ser-428/431 (in LKB1(L)), Ser-399 (in LKB1(S)) is a PKCzeta-dependent phosphorylation site essential for nucleocytoplasmic export of LKB1(S) and consequent AMPK activation.
23592276 LMP1-mediated AMPK inactivation contributes to the proliferation and transformation of epithelial cells, thereby implicating the LKB1-AMPK pathway in the Epstein-Barr virus (EBV)-driven pathogenesis of nasopharyngeal carcinoma (NPC).
23584481 LKB1 depletion induced the formation of chromosome breaks and radials. These results suggest that LKB1-AMPK signaling controls NHEJ and contributes to genome stability.
23572524 unctional interaction between LKB1 and Nischarin to inhibit cell migration and breast tumor progression
23526220 metformin suppresses STAT3 activation via LKB1-AMPK-mTOR-independent but ROS-related and autocrine IL-6 production-related pathways. Thus, metformin helps to overcome tumor drug resistance by targeting STAT3.
23451056 Loss of LKB1 expression reduces the latency of ErbB2-mediated mammary gland tumorigenesis, promoting changes in metabolic pathways.
23430953 Inactivation of transforming growth factor-beta/bone morphogenetic protein signalling and complete loss of LKB1 might be involved in dysplastic transformation of gastrointestinal hamartomas specifically.
23415580 Germline mutation of STK11 (Peutz-Jeghers syndrome) entails markedly elevated cancer risks, mainly for pancreatic and cervical cancers.
23399955 Seventy-seven patients (13%) were found to have colorectal polyposis-associated mutations, including 13 in STK11 (2.2%).
23393134 tumor suppressor kinase LKB1 activates the downstream kinases SIK2 and SIK3 to stimulate nuclear export of class IIa histone deacetylases
23367447 mathematical computer model of regulation of microRNA-451, LKB1 and AMPK in glioblastoma
23322200 results suggest that LKB1 acts as a tumour suppressor in most sporadic cases of clear cell renal cell carcinoma and that underexpression of LKB1 is a common event in the disease
23207623 The results suggest a possible link between downregulation of LKB1 and overexpression of SMAD4 in SGTs.
23086944 Post-translational modification of serine/threonine kinase LKB1 via Adduction of the Reactive Lipid Species 4-Hydroxy-trans-2-nonenal (HNE) at lysine residue 97 directly inhibits kinase activity.
23074285 CRTC1-NEDD9 signaling axis mediates lung cancer progression caused by LKB1 loss.
23044421 these results suggest that Artemis functions as a positive regulator of AMPK signaling by stabilizing the LKB1-AMPK complex.
23027127 LKB1 inhibited Yap independently of either AMPK or mTOR activation
22988252 Data suggest that macrophage migration inhibitory factor (MIF) and d-dopachrome tautomerase (d-DT) act cooperatively to inhibit steady-state phosphorylation and activation of AMPK in LKB1 wild type and LKB1 mutant non-small cell lung carcinomas cells.
22986809 Results suggest that LKB1 expression may be implicated in resistance to chemoradiotherapy (CRT), therefore contributing to tumor relapse in patients with locally advanced rectal cancer treated with preoperative CRT.
22983157 the orphan nuclear receptor Nur77 binds and sequesters LKB1 in the nucleus, thereby attenuating AMPK activation
22942091 Two missense mutations of the STK11 gene associated with Peutz-Jeghers syndrome.
22928647 One mutation in LKB1 was a previously unreported 30-base-pair deletion in exon 4, and the other was an intron mutation that affected splicing. The results support the hypothesis that mutation of the LKB1 gene is a cause of Peutz-Jeghers syndrome.
22848740 catabolic glucocorticoid hormones and high intracellular AMP levels cooperate in inducing FOXO3 transcription and in activating the corresponding protein
22814264 targets in LKB1 signaling pathway for non-small cell lung cancer therapy
22775437 The existence of seven different pathogenic mutations in STK11 gene in seven unrelated families.
22635025 Loss of Liver kinase B1 is associated with endometrial cancer.
22575644 autophosphorylation of Thr336 acts as an activating signal for LKB1 to recruit 14-3-3, which in turn attenuates the activation of LKB1 to keep the activity of LKB1 in check.
22543132 The missense mutation of 460 C-->G in exon 3 of STK11 gene is a novel mutation associated with Peutz-Jeghers syndrome.
22487816 Nine germline mutations of LKB1 gene were identified in eight PJS patients.
22460425 The lower rate of LKB1 somatic mutations in lung adenocarcinomas are characteristic of the Kujukuri cohort as compared to Caucasians.
22457270 Our results indicate that LKB1 gene may play a role in the progression of bladder cancer.
22412893 Gene expression of the tumour suppressor LKB1 is mediated by Sp1, NF-Y and FOXO transcription factors.
22384927 LKB1 controls the pluripotent state of human embryonic stem cells.
22265968 LKB1 was not induced in cells transfected with miR-199a-3p
22226967 ERalpha repressively modulates the expression of LKB1 at the transcriptional level.
22168747 A C > T substitution changed codon 302 from CAG (glutamine) to TAG (stop), truncating the STK11 protein, thus leading to the partial loss of the kinase domain and complete loss of the alpha-helix C-terminus.
22118009 A novel de novo mutation was identified in exon 5 of STK11, that resulted in a translational frameshift leading to termination at codon 236 in a child with Peutz-Jeghers syndrome
21994947 the curcumin/LKB1/AMPK/SMILE/PGC1alpha pathway differentially regulates ER stress-mediated gene transcription
21876548 Demonstrated for the first time that LKB1 is regulated by sex hormones in adipocytes.
21860411 Taken together, our results establish that the Hsp90-Cdc37 complex controls both the stability and activity of the LKB1 kinase.
21816872 The relatively high frequency of LKB1 mutations in mucinous bronchioloalveolar carcinoma patients may therefore suggest its involvement in lung carcinogenesis, at least in mucinous bronchioloalveolar carcinoma.
21706049 de-regulated LKB1-CRTC signaling might represent a crucial mechanism for esophageal cancer progression.
21572398 no evidence for a role for LKB1 in tumorigenesis of sporadic pancreatic acinar cell carcinoma was found.
21532627 these data identified total inactivation of the LKB1 gene by either HD or LOH with somatic mutation in 39% of tested samples, whereas loss of chromosome 19p region by HD or LOH at the LKB1 region occured in 90% of NSCLC.
21450399 LKB1 is a tissue and context-specific kinase [review]
21396365 REVIEW: most recent discoveries regarding participation of LKB1 and AMPK in signaling pathways that respond to cellular stress and damage; the relevance of this signaling for disease and therapy
21241696 REVIEW: clear tissue specific differences in LKB1 function in vivo and in the consequences of its loss
21192934 REVIEW: Molecular mechanisms of tumor suppression by LKB1
21191700 The LKB1 gene alteration is rare in Japanese patients with lung adenocarcinoma, and is generally limited to male smokers.
21191146 In tumor cells non-phosphorylated DeltaNp63alpha failed to form protein complexes with Rpn13, allowing the latter to bind and target LKB1 into a proteasome-dependent degradation pathway, modulating cisplatin-induced autophagy.
21118512 Thirteen different pathogenic mutations in STK11, including a high frequency of large genomic deletions (38%, 5/13), were identified in the 13 unrelated families studied.
21102257 review summarizes LKB1-dependent invasion pathways where compromised LKB1 function could promote non-small cell lung cancer metastasis(REVIEW)
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20974850 LKB1 and LIP1 provide negative control of TGFbeta signaling.
20956321 LKB1 loss of function promotes lung cancer malignancy through remodeling of extracellular matrix microenvironment, and identify LOX as a potential target for disease treatment in lung cancer patients.
20939895 regulates the actin cytoskeleton through a Dbl/Rho pathway
20881644 Observational study of gene-disease association. (HuGE Navigator)
20864035 Exogenous and intrinsic AID-induced DNA strand breaks in B-cells activate ATM, which signals through an LKB1 intermediate to inactivate CRTC2, resulting in repression of germinal center B-cell differentiation, while opposing lymphomagenesis.
20818976 A novel missense mutation in the nuclear localization signal coding region of the LKB1 gene was detected in 10 tumor samples from patients with head and neck cancer. Six different single-nucleotide substitutions were also observed in the introns.
20722467 CHEK2, STK11, and PALB2 mutations or large genomic rearrangements of either STK11 or PALB2 are rare, and do not contribute to a substantial fraction of breast cancer susceptibility in high-risk French Canadian breast cancer families.
20722467 Observational study of gene-disease association. (HuGE Navigator)
20686846 STK11 exon 7 duplication mutation is identified in Korean children with Peutz-Jeghers syndrome.
20682687 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20668229 The LKB1/AMPK/TSC tumor suppressor axis is functional in acute myeloid leukemia.
20623358 Data show that the deletions, ranging from 2.9 to 180 kb, removed one or more loci contiguous to the STK11 gene in six patients, while partial STK11 gene deletions were present in the remaining nine cases.
20559149 LKB1 mutations are associated with lung adenocarcinomas.
20559149 Observational study of gene-disease association. (HuGE Navigator)
20497868 Mutations in the LKB1 gene were identified in 57% of the Peutz-Jeghers syndrome probands in Taiwan.
20489196 The LKB1-AMPK signaling axis in endothelial cells is a positive regulator of the revascularization response to tissue ischemia.
20452353 Lkb1 heterozygosity can accelerate KrasG12D-induced pancratic ductal adenocarcinoma formation through the p53/p21 pathway.
20435009 Alu-mediated genomic deletion of the serine/threonine protein kinase 11 (STK11) gene in Peutz-Jeghers syndrome.
20428811 High LKB1 is associated with Peutz-Jeghers syndrome polyps.
20424326 aberrant nuclear accumulation of LKB1 caused by STRADalpha deficiency contributes to hyperactivation of mTORC1 signaling and disruption of neuronal lamination during corticogenesis
20423848 TGFbeta/Smad pathway is probably subject to regulation by LKB1 and may play a role in the occurrence of Peutz-Jeghers syndrome.
20418665 Adiponectin treatment increases the expression of tumor suppressor gene, LKB1 in breast cancer cells.
20400510 PAK1 is a direct downstream target of LKB1 and plays an essential role in LKB1-induced suppression of cell migration
20368693 Endogenous LKB1 knockdown accelerates cell cycle progression through G(1)/S checkpoint, mediated by decline of p53 and p16 pathways. Thus, loss of LKB1 expression in normal cells may contribute to the formation of malignancies.
20357370 In hyperinsulinemic girls with androgen excess, the STK11 rs8111699 single nucleotide polymorphism influences insulin sensitivity and metformin efficacy
20357370 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20354225 the LKB1-NUAK pathway has roles in controlling myosin phosphatase complexes and cell adhesion
20227367 miR-451 is a regulator of the LKB1/AMPK pathway, and this may represent a fundamental mechanism that contributes to glioma cell adaptation in response to altered energy availability.
20207041 involved of in epithelial-mesenchymal transition of lung cancer cells
20193846 Identified homozygous deletions in the HeLa and SiHa cells. Analysis in HeLa cells revealed that the deletion resulted from an Alu-recombination-mediated deletion & generated a novel LKB1 fusion transcript driven by an uncharacterized CpG island promoter.
20082862 somatic LKB1 mutations are apparently uncommon in Korean patients with NSCLC
20082862 Observational study of gene-disease association. (HuGE Navigator)
20057966 Observational study of gene-disease association. (HuGE Navigator)
20020146 Four of the five cases had germline mutations of LKB1, including two novel mutations, a one-base insertion at codon 53 and a large deletion encompassing exon 3 (codon 136-155).
20018878 LKB1 is involved in SR-BI-mediated but not in S1P receptor-mediated phosphorylation of AMPK, Akt, and eNOS.
20010869 Data show that somatic loss of LKB1 is associated with underphosphorylation of endogenous Crtc1, enhanced Crtc1 nuclear localization.
19908348 This study has expanded the genotypic spectrum of the STK11 gene in two unrelated individuals with Peutz-Jeghers syndrome
19892943 study describes structure of the core heterotrimeric LKB1-STRADalpha-MO25alpha complex, revealing an unusual allosteric mechanism of LKB1 activation; structure also reveals how mutations in Peutz-Jeghers syndrome & sporadic cancers impair LKB1 function
19727776 Observational study of gene-disease association. (HuGE Navigator)
19724060 LKB1 serine-threonine kinase is a tumor suppressor that is inactivated in a large number of sporadic human lung non-small cell carcinomas and cervical cancers.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19622832 SIK1 links LKB1 to p53-dependent anoikis and suppresses metastasis.
19615099 a germline mutation of STK11 gene can be found not only in probands fulfilling the Peutz-Jeghers syndrome diagnostic criteria, but also in some sporadic cases not complying with the criteria
19584313 Cellular polarity and energy metabolism are regulated through the conserved LKB1-AMPK signal transduction pathway.
19520843 Adiponectin activates AMP-activated protein kinase in muscle cells via APPL1/LKB1-dependent and phospholipase C/Ca2+/Ca2+/calmodulin-dependent protein kinase kinase-dependent pathways
19513107 ATP and MO25alpha cooperate to maintain STRADalpha in an "active" closed conformation required for LKB1 activation.
19507030 The results presented here enlarge the spectrum of mutations of the STK11 gene by identifying a de novo mutation in a PJS patient and further support the hypothesis that STK11 mutations are disease-causing mutations for PJS.
19463221 It is now possible to identify a specifi c LKB1/STK11 gene mutation in up to 95% of patients with phenotypic PJS, thus making the possibility of a second PJS locus less likely.
19414597 Results suggest that in multiple cell types the signaling pathways engaged by several stimuli converge upon PKC-zeta-dependent LKB1 phosphorylation at serine 307, which directs the nucleocytoplasmic transport of LKB1 and consequent AMPK activation.
19407487 Growth of cervical cancer cells was inhibited through activation of CAMKK2 and LBK1.
19386264 These data define a brush border induction pathway downstream of the Lkb1/Strad/Mo25 polarization complex, yet separate from other polarity events.
19369417 LKB1 / STK11 functions as a coactivator of estrogen receptor alpha signaling. LKB1 was found to bind to ERalpha and was found to be recruited to the promoters of estrogen responsive genes, altering their expression.
19369417 Results place LKB1 in a coactivator role for ERalpha signaling, broadening the scientific scope of this tumor suppressor kinase and laying the groundwork for the use of LKB1 as a target for the development of new therapies against breast cancer.
19351817 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19340305 LKB1 is thus a major cervical tumor suppressor, demonstrating that acquired genetic alterations drive progression of HPV-induced dysplasias to invasive, lethal cancers
19287990 Overexpression of the LKB1 gene inhibits lung carcinoma cell proliferation partly through degradation of c-myc protein.
19250387 Two novel LKB1 mutations in Colombian Peutz-Jeghers syndrome patients
19229701 Somatic alterations of the serine/threonine kinase LKB1 gene in squamous cell and large cell lung carcinoma.
19229701 Observational study of gene-disease association. (HuGE Navigator)
19204826 LKB1 has now been demonstrated to play a crucial role in pulmonary tumorigenesis, controlling initiation, differentiation, and metastasis. Review.
19177591 Part of a cascade that functions as a critical determinant of hepatocyte proliferation during liver regeneration after partial hepatectomy.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19165201 LKB1 and KRAS mutation is associated with lung cancers and show sensitivity to the mTOR and MEK inhibitors.
19145097 Identification of STK11 mutations in patients and their relatives can help to improve the clinical management.
19068194 LKB1 protein might inhibit malignant biological behavior of A549 cells partly by down-regulating the tyrosine-phosphorylated level of STAT3 protein.
19029933 Role of LKB1 as a master regulator of polarity and metabolism could contribute to its tumor suppressor function.
18854318 STRADalpha.MO25alpha complexes containing LKB1 variants were equally effective at phosphorylating and activating AMPK, BRSK1, and BRSK2
18794113 Suppression of LKB1 expression led to apoptosis in three cell lines in which Akt is constitutively active but not in two cell lines without Akt activation.
18687677 LKB1 deacetylation is regulated by SIRT1 and that this in turn influences its intracellular localization, association with STRAD, kinase activity, and ability to activate AMPK.
18681789 A polymorphism in the STK11 gene is associated with low ovulatory response to treatment with metformin alone in a prospective, randomized trial.
18681789 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18600394 Peutz-Jeghers syndrome with germline mutation of LKB1
18594528 LKB1 mutation frequency was higher in NSCLC tumours of US origin compared with NSCLCs of Korean origin. They tended to occur more commonly in adenocarcinomas than in squamous cell carcinomas.
18594528 Observational study of gene-disease association. (HuGE Navigator)
18495044 Results enlarge the spectrum of mutations of the STK11 gene by identifying a novel de novo mutation in a PJS patient and further support the hypothesis that STK11 mutations are disease-causing mutations for PJS with or without a positive family history
18483235 LKB1 may have a role in lung cancer [review]
18403917 plays important roles in regulating metabolism in resting and contracting skeletal muscle (Review)
18321849 PKCzeta mediates LKB1-dependent Akt inhibition in response to peroxynitrite, resulting in endothelial apoptosis.
18303014 rosiglitazone is able to acutely stimulate NO synthesis in cultured endothelial cells by an AMP-activated protein kinase-dependent mechanism, likely to be mediated by LKB1
18256292 identify a multifactored mechanism to control LKB1 localization, and they suggest that the STRADbeta-LKB1 complex might possess unique functions in the nucleus
18245474 LKB1 interacts only with active form of cdc42 and PAK, but not with inactive cdc42. Taken together, these results show that LKB1 is a critical mediator of the NSCLC polarity program in lung cancer cells through a novel LKB1-cdc42-PAK pathway.
18199157 Marked reduction of LKB1 expression in high-grade neuroendocrine tumors of the lung suggests a possible role of LKB1 inactivation in its tumorigenesis.
18000088 a polymorphism in STK11, a kinase gene expressed in liver and implicated in metformin action, is associated with ovulatory response to treatment with metformin alone.
17950019 genetic variants of LKB1-AMPK-TORC2 pathway components may exert a weak influence on the occurrence of type 2 diabetes in Japanese
17950019 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17928927 Recombinant LKB1 produces significant growth inhibition and cell-cycle arrest.
17921699 The discovery of several novel splice isoforms of STRADalpha that differentially affect the kinase activity, complex assembly, subcellular localization of LKB1 and the activation of the LKB1-dependent AMPK pathway.
17921699 Several novel splice isoforms of STRADalpha that differentially affect the kinase activity, complex assembly, subcellular localization of LKB1 and the activation of the LKB1-dependent AMPK pathway were discovered.
17884763 Down-regulation of LKB1 gene expression can stimulate malignant biological behavior of lung carcinoma cells.
17766436 A role has been identified for the polarity regulator LKB1 in the development of c-Myc- resistant cell organization.
17711506 Observational study of genotype prevalence. (HuGE Navigator)
17711506 LKB1 gene mutations were relatively rare in Japanese patients with lung cancer compared with Caucasian patients.
17676035 inactivation of LKB1 was found in 34% and 19% of 144 analysed human lung adenocarcinomas and squamous cell carcinomas, respectively
17641416 N33, STK11 (19p13) and TP53 might play a role in the development of metastasis in larynx and pharynx squamous cell carcinomas.
17637250 sequencing of the STK11 gene in the probands of 3 Chinese families with Peutz-Jeghers syndrome revealed two novel mutations (c180C-->G and c998-1002delGCAGC) in exon 1 and exon 8, respectively
17599048 LKB1 gene is located in the short arm of chromosome 19, which is frequently deleted in many tumors of sporadic origin.
17575127 LKB1 catalytically deficient mutants possess oncogenic properties. This work is the first to describe a function for LKB1 mutants; recruitment to the promoter of cyclin D1 where mutants enhance the expression of the oncogene.
17573348 LKB1 is involved in the regulation of microtubule dynamics through the activation of MARKs
17384680 Observational study of genotype prevalence. (HuGE Navigator)
17384680 somatic LKB1 genetic alterations preferentially occur in a subset of poorly differentiated lung adenocarcinomas that appear to correlate with smoking males
17344591 Observational study of gene-disease association. (HuGE Navigator)
17319781 STK11 germline mutations is associated with Peutz-Jeghers syndrome
17244606 protein kinase B, LKB1, and AMP-activated protein kinase have roles in activation of lipoprotein lipase by glucose-dependent insulinotropic polypeptide in adipocytes
17234589 Phosphorylation of PAR-1 by tumor suppressor protein LKB1 is required for PAR-1 activation, which promotes tau phosphorylation.
17216128 Results suggest that WDR6 is implicated in the cell growth inhibitory pathway of LKB1 via regulation of p27(Kip1).
17212587 expression of LKB1 protects cells from cytotoxicity induced by agents which modulate ATP/AMP ratio
17114342 LKB1 plays a negative regulatory role in human breast cancer.
17108107 Chromatin immunoprecipitation analyses show that LKB1 is recruited directly to the p21/WAF1 promoter, as well as to other p53 activated promoters, in a p53-dependent fashion.
17098823 Increased transsfected LKB1 activity in the cardiac myocyte can decrease hypertrophy-induced protein synthesis and suggest that LKB1 activation may be a method for the prevention of pathological cardiac hypertrophy.
17026623 most, if not all PJS, is attributable to mutations in the STK11 gene, perhaps including as yet undiscovered changes in promoter or enhancer sequences or other cryptic changes
17010524 Here we review how the substrates & cellular functions of LKB1 may be linked to Peutz-Jeghers syndrome & other diseases, & discuss how some of the molecular changes associated with altered LKB1 signaling might be used in therapeutic approaches.[review]
16953221 demonstrate that LKB1 wild-type cells are more resistant to cell death upon glucose withdrawal than their mutant counterparts
16927138 Genomic DNA analysis showed a 708-bp deletion in the STK11 gene
16912160 PEA3 stabilization due to LKB1 inactivation could lead to epithelial/mesenchymal transition and greater lung cancer invasion potential.
16882735 The risk of intussusception in PJS is not influenced by STK11 mutation status.
16822578 loss of function mutations in LKB1 may also be frequently involved in the pathogenesis of large cell lung carcinomas
16648371 Deletions within the LKB1 gene are associated with Peutz-Jeghers syndrome.
16582077 Exonic STK11 deletions are a common cause of Peutz-Jeghers syndrome.
16580634 LKB1 regulates GATA-mediated gene expression and that this activity of LKB1 may be important for its tumor suppressor function.
16540748 Meta-analysis and HuGE review of genotype prevalence, gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
16407837 Mutation of STK11/LKB1 gene leads to the loss of cell growth inhibition in head and neck squamous cell carcinoma
16407220 LKB1-mediated AMP-activated protein kinase (AMPK) activation may play an important role in regulating not only cellular energy metabolism but also signaling pathways that control cell growth, differentiation, and survival.
16396636 The role of LKB1 in the phosphorylation and activation of multiple AMP-kinase related protein kinases is reported.
16311241 Ectopic expression of cyclooxygenase-2 and endogenous biosynthesis of eicosanoids also inhibited LKB1 activity in MCF-7 cells.
16287113 Large genomic deletions within the STK11 gene are associated with Peutz-Jeghers syndrome.
15987703 LKB1 interacts with and phosphorylates PTEN: a functional link between two proteins involved in cancer predisposing syndromes
15800014 LKB1 is crucial for the regulation of cell polarity
15774015 promoter element sequence changes in STK11/LKB1 are unlikely to contribute to Peutz-Jeghers syndrome
15731909 LKB1 mutants, in Peutz-Jeghers syndrome, fail to activate GSK-3beta, preventing it from inhibiting Wnt signaling.
15617552 report of a novel truncating-type germline mutation of the STK11 gene in a Peutz-Jeghers syndrome patient with gastric cancer
15608654 The unusual splicing defect of LKB1 associated with this Peutz-Jeghers syndrome-causing mutation uncovers differences in splice-site recognition between the major and minor pre-mRNA splicing pathways
15561763 Mutations in LKB1 cause the inherited Peutz-Jeghers syndrome.
15485651 IGF-1 induces AMPK-alpha subunit phosphorylation via an ATM-dependent and LKB1-independent pathway
15331174 Observational study of genotype prevalence. (HuGE Navigator)
15287029 Cases in which Peutz-Jegher Syndrome patients did not harbor mutation of STK11.
15231735 LKB1, the gene mutated in Peutz-Jeghers syndrome (PJS), acts as a tumor suppressor by activating TSC2, the gene mutated in Tuberous sclerosis complex
15188174 Observational study of gene-disease association. (HuGE Navigator)
15188174 the risk for developing cancer at ages 20, 30, 40, 50, 60, and 70 years was 1%, 3%, 19%, 32%, 63%, and 81%, respectively
15121768 Observational study of gene-disease association. (HuGE Navigator)
15077168 our results reveal that several important factors contribute to LKB1-mediated carcinogenesis in LADs, confirming previous observations and identifying new putative pathways that should help to elucidate the biological role of LKB1.
14985505 LKB1 directly phosphorylates Thr-172 of AMPKalpha in vitro and activates its kinase activity.
14976552 LKB1 functions as a master upstream protein kinase, regulating AMPK-related kinases as well as AMPK.
14668798 heteromeric complex containing the molecular chaperones Hsp90 and Cdc37/p50 interacts with the kinase domain of LKB1
14511408 LKB1-induced apoptosis is p53 independent but might be p73-mediated in pancreatic tumors
12912948 LKB1 inactivation may play a role in the critical transition from premalignant to malignant tumor growth
12879020 results show that LKB1 can direct the phosphorylation of the serine-threonine kinase PAR1A
12847291 LKB1 kinase, which is associated with Peutz-Jeghers cancer-susceptibility syndrome, phosphorylates and activates AMPK in vitro.
12805220 identification and characterization of an LKB1-specific adaptor protein and substrate, STRAD (STe20 Related ADaptor); results imply that STRAD plays a key role in regulating the tumour suppressor activities of LKB1
12552571 LKB1/STK11 variants in a group of Peutz-Jeghers syndrome Italian patients lack serine/threonine kinase activity, in contrast to wild type LKB1/STK11, and are unable to suppress the growth of melanoma G361 cells in vitro.
12533684 mutations in the STK11 gene characterize minimal deviation adenocarcinoma of the uterine cervix
12489981 Results show that Cdc37 and heat shock protein 90 bind specifically to the kinase domain of LKB1.
12234250 These observations provide the first link between ATM and LKB1 and suggest that ATM could regulate LKB1
12218179 polyps arising in the Lkb1+/- mice were found to be hamartomas that were histologically indistinguishable from polyps resected from PJS patients, indicating that Lkb1+/- mice model human PJS polyposis
12097271 This reports for the first time the presence of frequent LKB1 inactivating mutations in human lung cancer.
12097271 Inactivation of LKB1/STK11 is a common event in adenocarcinomas of the lung.
11853558 LKB1 is phosphorylated at Ser(431), Ser(31), Ser(325) and Thr(366)
11733352 STK11/LKB1 gene in IPMNs (intraductal papillary-mucinous neoplasms of the pancreas) with LOH revealed a germline mutation in one IPMN that arose in a patient with PJS (Peutz-Jeghers Syndrome) and a somatic mutation in 1 of the 20 sporadic IPMNs.
11668633 mutation screening at the RNA level in Peutz-Jeghers syndrome reveals complex splicing abnormalities and a novel mRNA isoform (STK11 c.597(insertion mark)598insIVS4
11445556 This paper describes the identification and characterization of the first binding partner of LKB1; the SWI/SNF chromatin remodeling protein Brg1.

AA Sequence

MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSE      1 - 70
TLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEML     71 - 140
DSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTC    141 - 210
RTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGP    211 - 280
PLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADED    281 - 350
EDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSA    351 - 420
SSKIRRLSACKQQ                                                             421 - 433
//

Text Mined References (355)

PMID Year Title
27060312 2016 [Mutations of the STK11 and FHIT genes among patients with Peutz-Jeghers syndrome].
27035914 2016 The Prognostic Value of Decreased LKB1 in Solid Tumors: A Meta-Analysis.
26976973 2016 Decreased Expression of Tumor-suppressor Gene LKB1 Correlates with Poor Prognosis in Human Gastric Cancer.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26833127 2016 STK11/LKB1 Deficiency Promotes Neutrophil Recruitment and Proinflammatory Cytokine Production to Suppress T-cell Activity in the Lung Tumor Microenvironment.
26662608 2016 STK11 Mutation Identified in Thyroid Carcinoma.
26616116 2015 Low LKB1 Expression Results in Unfavorable Prognosis in Prostate Cancer Patients.
26607058 2015 Clinical characteristics and STK11 gene mutations in Chinese children with Peutz-Jeghers syndrome.
26549522 2016 Clinical significance and role of LKB1 in gastric cancer.
26517522 2016 Integrin ?3 and LKB1 are independently involved in the inhibition of proliferation by lovastatin in human intrahepatic cholangiocarcinoma.
26479318 2015 6-Phosphogluconate dehydrogenase links oxidative PPP, lipogenesis and tumour growth by inhibiting LKB1-AMPK signalling.
26470595 2015 Deoxypodophyllotoxin suppresses tumor vasculature in HUVECs by promoting cytoskeleton remodeling through LKB1-AMPK dependent Rho A activatio.
26458553 2015 Additive effects of eukaryotic co?expression plasmid carrying GRIM?19 and LKB1 genes on breast cancer in vitro and in vivo.
26413869 2015 LKB1 loss promotes endometrial cancer progression via CCL2-dependent macrophage recruitment.
26398719 2015 Role of the LKB1/AMPK pathway in tumor invasion and metastasis of cancer cells (Review).
26386697 2016 First report of somatic mosaicism for mutations in STK11 in four patients with Peutz-Jeghers syndrome.
26359358 2015 Honokiol activates LKB1-miR-34a axis and antagonizes the oncogenic actions of leptin in breast cancer.
26345094 2015 The genetic polymorphism in the STK11 does not affect gestational diabetes.
26212320 2015 A Critical SUMO1 Modification of LKB1 Regulates AMPK Activity during Energy Stress.
26147831 2016 Polycystic ovary syndrome (PCOS) with melanocytic mucosal macules: the role of STK11 gene polymorphisms in PCOS and Peutz-Jeghers syndrome.
26068970 2015 Intact LKB1 activity is required for survival of dormant ovarian cancer spheroids.
26056085 2015 Underexpression of LKB1 tumor suppressor is associated with enhanced Wnt signaling and malignant characteristics of human intrahepatic cholangiocarcinoma.
26027660 2015 LKB1 gene inactivation does not sensitize non-small cell lung cancer cells to mTOR inhibitors in vitro.
25894929 2015 Disruption of BASIGIN decreases lactic acid export and sensitizes non-small cell lung cancer to biguanides independently of the LKB1 status.
25874865 2015 MLK3 phophorylates AMPK independently of LKB1.
25874445 2015 LKB1 couples glucose metabolism to insulin secretion in mice.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25850957 2015 The effect of LKB1 on the PI3K/Akt pathway activation in association with PTEN and PIK3CA in HNC.
25841653 2015 Specific Alu elements involved in a significant percentage of copy number variations of the STK11 gene in patients with Peutz-Jeghers syndrome.
25798842 2016 Loss of LKB1 and p53 synergizes to alter fallopian tube epithelial phenotype and high-grade serous tumorigenesis.
25769882 2015 Re-expression of LKB1 in LKB1-mutant EKVX cells leads to resistance to paclitaxel through the up-regulation of MDR1 expression.
25751324 Identification of Unique, Heterozygous Germline Mutation, STK11 (p.F354L), in a Child with an Encapsulated Follicular Variant of Papillary Thyroid Carcinoma within Six Months of Completing Treatment for Neuroblastoma.
25737507 2015 Immunohistochemical Loss of LKB1 Is a Biomarker for More Aggressive Biology in KRAS-Mutant Lung Adenocarcinoma.
25728766 2015 Skp2-dependent ubiquitination and activation of LKB1 is essential for cancer cell survival under energy stress.
25695224 2015 Somatic STK11 and concomitant STK11/KRAS mutational frequency in stage IV lung adenocarcinoma adrenal metastases.
25694554 A single-nucleotide polymorphism in serine-threonine kinase 11, the gene encoding liver kinase B1, is a risk factor for multiple sclerosis.
25674212 2014 LKB1 suppresses proliferation and invasion of prostate cancer through hedgehog signaling pathway.
25650664 2015 Stabilization of LKB1 and Akt by neddylation regulates energy metabolism in liver cancer.
25510663 2015 MicroRNA-17 promotes normal ovarian cancer cells to cancer stem cells development via suppression of the LKB1-p53-p21/WAF1 pathway.
25465874 2015 Role of LKB1-CRTC1 on glycosylated COX-2 and response to COX-2 inhibition in lung cancer.
25399650 2014 Probucol suppresses human glioma cell proliferation in vitro via ROS production and LKB1-AMPK activation.
25362209 2015 MicroRNA-451 exacerbates lipotoxicity in cardiac myocytes and high-fat diet-induced cardiac hypertrophy in mice through suppression of the LKB1/AMPK pathway.
25349262 2014 LKB1 loss in melanoma disrupts directional migration toward extracellular matrix cues.
25329316 2014 A mouse model uncovers LKB1 as an UVB-induced DNA damage sensor mediating CDKN1A (p21WAF1/CIP1) degradation.
25263448 2015 LKB1 reduces ROS-mediated cell damage via activation of p38.
25244018 2014 Recent progress on liver kinase B1 (LKB1): expression, regulation, downstream signaling and cancer suppressive function.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25224251 2014 Alterations of LKB1 and KRAS and risk of brain metastasis: comprehensive characterization by mutation analysis, copy number, and gene expression in non-small-cell lung carcinoma.
25180605 2014 Protein kinase LKB1 promotes RAB7-mediated neuropilin-1 degradation to inhibit angiogenesis.
25179843 2014 Novel mutations and role of the LKB1 gene as a tumor suppressor in renal cell carcinoma.
25178656 2014 Loss of LKB1 disrupts breast epithelial cell polarity and promotes breast cancer metastasis and invasion.
25175672 2014 Reduced expression of liver kinase B1 and Beclin1 is associated with the poor survival of patients with non-small cell lung cancer.
25155037 2014 Mir-155 promotes cervical cancer cell proliferation through suppression of its target gene LKB1.
25122068 2014 Integrated analysis of transcriptomes of cancer cell lines and patient samples reveals STK11/LKB1-driven regulation of cAMP phosphodiesterase-4D.
25114112 2014 The serine/threonine kinase STK11 promotes Shigella flexneri dissemination through establishment of cell-cell contacts competent for tyrosine kinase signaling.
25042806 2014 An AMPK-independent signaling pathway downstream of the LKB1 tumor suppressor controls Snail1 and metastatic potential.
25042259 2014 Loss of LKB1 in high-grade endometrial carcinoma: LKB1 is a novel transcriptional target of p53.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
25011082 2014 LKB1 inactivation sensitizes non-small cell lung cancer to pharmacological aggravation of ER stress.
24998845 2015 A novel LKB1 isoform enhances AMPK metabolic activity and displays oncogenic properties.
24928005 2014 [Mutation analysis of STK11 gene in a Chinese family with Peutz-Jeghers syndrome].
24913037 2014 The transcriptional responsiveness of LKB1 to STAT-mediated signaling is differentially modulated by prolactin in human breast cancer cells.
24828662 2014 LKB1 Loss induces characteristic patterns of gene expression in human tumors associated with NRF2 activation and attenuation of PI3K-AKT.
24793789 2015 The MZF1/c-MYC axis mediates lung adenocarcinoma progression caused by wild-type lkb1 loss.
24792998 2014 Expression and transcriptional profiling of the LKB1 tumor suppressor in cervical cancer cells.
24770722 2014 Genetic variations in STK11, PRKAA1, and TSC1 associated with prognosis for patients with colorectal cancer.
24722282 2014 Liver kinase B1 regulates the centrosome via PLK1.
24676538 2014 Downregulation of LKB1 suppresses Stat3 activity to promote the proliferation of esophageal carcinoma cells.
24652667 2014 STK11 domain XI mutations: candidate genetic drivers leading to the development of dysplastic polyps in Peutz-Jeghers syndrome.
24647869 2014 Suppression of lung cancer cell invasion by LKB1 is due to the downregulation of tissue factor and vascular endothelial growth factor, partly dependent on SP1.
24645967 2014 Aging-related changes in inflammatory and LKB1/AMPK gene expression in fibromyalgia patients.
24615515 2014 LKB1 when associated with methylatedER? is a marker of bad prognosis in breast cancer.
24604241 2014 Novel and recurrent mutations of STK11 gene in six Chinese cases with Peutz-Jeghers syndrome.
24550282 2014 Loss of the tumor suppressor LKB1 promotes metabolic reprogramming of cancer cells via HIF-1?.
24469340 2014 Exogenous activation of LKB1/AMPK signaling induces G? arrest in cells with endogenous LKB1 expression.
24468202 2014 Prediction for response duration to epidermal growth factor receptor-tyrosine kinase inhibitors in EGFR mutated never smoker lung adenocarcinoma.
24419424 2014 Integrative genomic analysis reveals a high frequency of LKB1 genetic alteration in Chinese lung adenocarcinomas.
24387336 2014 Targeting the LKB1 tumor suppressor.
24362629 2014 A genetic screen identifies an LKB1-MARK signalling axis controlling the Hippo-YAP pathway.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24285539 2014 Liver kinase B1 expression promotes phosphatase activity and abrogation of receptor tyrosine kinase phosphorylation in human cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24170201 2014 Loss of LKB1 and PTEN tumor suppressor genes in the ovarian surface epithelium induces papillary serous ovarian cancer.
24154639 2014 Exome sequencing revealed novel germline mutations in Chinese Peutz-Jeghers syndrome patients.
24146957 2013 The tumor suppressor gene TUSC2 (FUS1) sensitizes NSCLC to the AKT inhibitor MK2206 in LKB1-dependent manner.
24086281 2013 The LKB1 tumor suppressor as a biomarker in mouse and human tissues.
24074562 2013 The LKB1 tumor suppressor differentially affects anchorage independent growth of HPV positive cervical cancer cell lines.
24037887 2013 Overexpression of aromatase associated with loss of heterozygosity of the STK11 gene accounts for prepubertal gynecomastia in boys with Peutz-Jeghers syndrome.
24022664 2014 The tumor suppressor LKB1 antagonizes WNT signaling pathway through modulating GSK3? activity in cell growth of esophageal carcinoma.
23995788 2014 LKB1 loss by alteration of the NKX2-1/p53 pathway promotes tumor malignancy and predicts poor survival and relapse in lung adenocarcinomas.
23892522 2013 Analysis of STK11 gene variant in five Chinese patients with Peutz-Jeghers syndrome.
23883619 2013 Linked decreases in liver kinase B1 and AMP-activated protein kinase activity modulate matrix catabolic responses to biomechanical injury in chondrocytes.
23878245 2013 Reactive nitrogen species regulate autophagy through ATM-AMPK-TSC2-mediated suppression of mTORC1.
23861764 2013 LKB1 inhibits breast cancer partially through repressing the Hedgehog signaling pathway.
23810581 2013 LKB1 downregulation may be independent of promoter methylation or FOXO3 expression in head and neck cancer.
23706335 2013 A common gene variant in STK11 is associated with metabolic risk markers and diabetes during gestation.
23679304 2013 Decreased expression of LKB1 correlates with poor prognosis in hepatocellular carcinoma patients undergoing hepatectomy.
23664447 2013 Genetic and epigenetic alterations of the LKB1 gene and their associations with mutations in TP53 and EGFR pathway genes in Korean non-small cell lung cancers.
23648482 2013 LKB1 controls human bronchial epithelial morphogenesis through p114RhoGEF-dependent RhoA activation.
23645358 2013 Clonality analysis suggests that STK11 gene mutations are involved in progression of lobular endocervical glandular hyperplasia (LEGH) to minimal deviation adenocarcinoma (MDA).
23637231 2013 LKB1 represses focal adhesion kinase (FAK) signaling via a FAK-LKB1 complex to regulate FAK site maturation and directional persistence.
23612973 2013 Phosphorylation of serine 399 in LKB1 protein short form by protein kinase C? is required for its nucleocytoplasmic transport and consequent AMP-activated protein kinase (AMPK) activation.
23592276 2013 Inhibition of the LKB1-AMPK pathway by the Epstein-Barr virus-encoded LMP1 promotes proliferation and transformation of human nasopharyngeal epithelial cells.
23584481 2014 Possible involvement of LKB1-AMPK signaling in non-homologous end joining.
23572524 2013 Integrin-binding protein nischarin interacts with tumor suppressor liver kinase B1 (LKB1) to regulate cell migration of breast epithelial cells.
23526220 2013 Metformin enhances cisplatin cytotoxicity by suppressing signal transducer and activator of transcription-3 activity independently of the liver kinase B1-AMP-activated protein kinase pathway.
23451056 2013 Loss of LKB1 expression reduces the latency of ErbB2-mediated mammary gland tumorigenesis, promoting changes in metabolic pathways.
23430953 2013 Identification of molecular alterations in gastrointestinal carcinomas and dysplastic hamartomas in Peutz-Jeghers syndrome.
23415580 2013 Cancer risk associated with STK11/LKB1 germline mutations in Peutz-Jeghers syndrome patients: results of an Italian multicenter study.
23399955 2013 Prevalence of germline PTEN, BMPR1A, SMAD4, STK11, and ENG mutations in patients with moderate-load colorectal polyps.
23393134 2013 The tumor suppressor kinase LKB1 activates the downstream kinases SIK2 and SIK3 to stimulate nuclear export of class IIa histone deacetylases.
23367447 2012 A computational multiscale model of glioblastoma growth: regulation of cell migration and proliferation via microRNA-451, LKB1 and AMPK.
23322200 2013 Underexpression of tumour suppressor LKB1 in clear cell renal cell carcinoma is common and confers growth advantage in vitro and in vivo.
23207623 2012 Could a possible crosstalk between AMPK and TGF-? signaling pathways be a key player in benign and malignant salivary gland tumors?.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23086944 2012 Post-translational modification of serine/threonine kinase LKB1 via Adduction of the Reactive Lipid Species 4-Hydroxy-trans-2-nonenal (HNE) at lysine residue 97 directly inhibits kinase activity.
23074285 2012 The CRTC1-NEDD9 signaling axis mediates lung cancer progression caused by LKB1 loss.
23044421 2012 The nuclear protein Artemis promotes AMPK activation by stabilizing the LKB1-AMPK complex.
23027127 2013 LKB1 tumor suppressor regulates AMP kinase/mTOR-independent cell growth and proliferation via the phosphorylation of Yap.
22988252 2012 Negative regulation of AMP-activated protein kinase (AMPK) activity by macrophage migration inhibitory factor (MIF) family members in non-small cell lung carcinomas.
22986809 2013 Significant correlation between LKB1 and LGR5 gene expression and the association with poor recurrence-free survival in rectal cancer after preoperative chemoradiotherapy.
22983157 2012 The orphan nuclear receptor Nur77 regulates LKB1 localization and activates AMPK.
22942091 2012 Two variants in STK11 gene in Chinese patients with Peutz-Jeghers syndrome.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
22928647 2012 One novel deletion and one splicing mutation of the LKB1 gene in two Chinese patients with Peutz-Jeghers syndrome.
22848740 2012 FOXO3 is a glucocorticoid receptor target and regulates LKB1 and its own expression based on cellular AMP levels via a positive autoregulatory loop.
22814264 2012 [Progress of related targets in LKB1 signaling pathway for non-small cell lung cancer therapy].
22775437 2013 Large deletions and splicing-site mutations in the STK11 gene in Peutz-Jeghers Chilean families.
22635025 2012 Not all fat is equal: differential gene expression and potential therapeutic targets in subcutaneous adipose, visceral adipose, and endometrium of obese women with and without endometrial cancer.
22575644 2012 14-3-3 interacts with LKB1 via recognizing phosphorylated threonine 336 residue and suppresses LKB1 kinase function.
22543132 2012 [Mutation analysis of STK11 gene coding region for 20 Chinese patients with Peutz-Jeghers syndrome].
22487816 2012 [Mutation screening of LKB1 gene in familial Peutz-Jeghers syndrome patients].
22460425 2012 LKB1, TP16, EGFR, and KRAS somatic mutations in lung adenocarcinomas from a Chiba Prefecture, Japan cohort.
22457270 2013 LKB1 mutations and their correlation with LKB1 and Rheb expression in bladder cancer.
22412893 2012 Gene expression of the tumour suppressor LKB1 is mediated by Sp1, NF-Y and FOXO transcription factors.
22384927 2012 LKB1 controls the pluripotent state of human embryonic stem cells.
22265968 2012 Farnesoid X receptor protects hepatocytes from injury by repressing miR-199a-3p, which increases levels of LKB1.
22226967 2012 Liver kinase B1 expression (LKB1) is repressed by estrogen receptor alpha (ER?) in MCF-7 human breast cancer cells.
22168747 2011 A novel mutation in STK11 gene is associated with Peutz-Jeghers syndrome in Chinese patients.
22118009 2011 Identification of a novel de novo STK11 mutation in a Chinese child with Peutz-Jeghers syndrome.
22005930 2012 Genome-wide association study of Alzheimer's disease with psychotic symptoms.
21994947 2011 Curcumin differentially regulates endoplasmic reticulum stress through transcriptional corepressor SMILE (small heterodimer partner-interacting leucine zipper protein)-mediated inhibition of CREBH (cAMP responsive element-binding protein H).
21876548 2012 Regulation of LKB1 expression by sex hormones in adipocytes.
21860411 2012 Molecular chaperone complexes with antagonizing activities regulate stability and activity of the tumor suppressor LKB1.
21816872 2011 LKB1 mutations frequently detected in mucinous bronchioloalveolar carcinoma.
21706049 2012 Altered LKB1/CREB-regulated transcription co-activator (CRTC) signaling axis promotes esophageal cancer cell migration and invasion.
21572398 2011 Analysis of LKB1 mutations and other molecular alterations in pancreatic acinar cell carcinoma.
21532627 2011 Frequent homozygous deletion of the LKB1/STK11 gene in non-small cell lung cancer.
21450399 2011 Liver kinase B1 (LKB1) in the pathogenesis of epithelial cancers.
21411391 2011 A novel de novo mutation in LKB1 gene in a Chinese Peutz Jeghers syndrome patient significantly diminished p53 activity.
21396365 2011 The role of LKB1 and AMPK in cellular responses to stress and damage.
21380642 2011 LKB1 in lung cancerigenesis: a serine/threonine kinase as tumor suppressor.
21317932 2011 A new role of NUAK1: directly phosphorylating p53 and regulating cell proliferation.
21269460 2011 Initial characterization of the human central proteome.
21241696 2011 LKB1 loss of function studied in vivo.
21192934 2011 Molecular mechanisms of tumor suppression by LKB1.
21191700 2011 LKB1 gene alterations in surgically resectable adenocarcinoma of the lung.
21191146 2010 Phospho-?Np63?/Rpn13-dependent regulation of LKB1 degradation modulates autophagy in cancer cells.
21118512 2010 High prevalence of germline STK11 mutations in Hungarian Peutz-Jeghers Syndrome patients.
21102257 2010 LKB1 regulated pathways in lung cancer invasion and metastasis.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20974850 2011 Negative regulation of TGF? signaling by the kinase LKB1 and the scaffolding protein LIP1.
20956321 2010 LKB1 inhibits lung cancer progression through lysyl oxidase and extracellular matrix remodeling.
20939895 2010 LKB1 tumor suppressor protein regulates actin filament assembly through Rho and its exchange factor Dbl independently of kinase activity.
20881644 2010 Somatic mutations in epidermal growth factor receptor signaling pathway genes in non-small cell lung cancers.
20864035 2010 AID-induced genotoxic stress promotes B cell differentiation in the germinal center via ATM and LKB1 signaling.
20818976 2010 Genetic alterations of the LKB1 gene in head and neck cancer.
20722467 2010 Evaluation of the contribution of the three breast cancer susceptibility genes CHEK2, STK11, and PALB2 in non-BRCA1/2 French Canadian families with high risk of breast cancer.
20686846 2011 Functional consequence of the STK11 exon 7 duplication mutation identified in a Korean child with Peutz-Jeghers syndrome.
20682687 2010 Common variants in 40 genes assessed for diabetes incidence and response to metformin and lifestyle intervention in the diabetes prevention program.
20668229 2010 The LKB1/AMPK signaling pathway has tumor suppressor activity in acute myeloid leukemia through the repression of mTOR-dependent oncogenic mRNA translation.
20623358 2010 Breakpoint determination of 15 large deletions in Peutz-Jeghers subjects.
20562859 2010 Network organization of the human autophagy system.
20559149 2010 Spectrum of LKB1, EGFR, and KRAS mutations in chinese lung adenocarcinomas.
20497868 2010 Clinical and genetic analysis of Peutz-Jeghers syndrome patients in Taiwan.
20489196 2010 LKB1 deficiency in Tie2-Cre-expressing cells impairs ischemia-induced angiogenesis.
20452353 2010 LKB1 haploinsufficiency cooperates with Kras to promote pancreatic cancer through suppression of p21-dependent growth arrest.
20435009 2010 Alu-mediated genomic deletion of the serine/threonine protein kinase 11 (STK11) gene in Peutz-Jeghers syndrome.
20428811 2010 Wnt signaling may be activated in a subset of Peutz-Jeghers syndrome polyps closely correlating to LKB1 expression.
20424326 2010 STRADalpha deficiency results in aberrant mTORC1 signaling during corticogenesis in humans and mice.
20423848 2010 [Expression of the proteins associated with transforming growth factor-beta/Smad signaling pathway in Peutz-Jeghers syndrome].
20418665 Metastasis suppression by adiponectin: LKB1 rises up to the challenge.
20400510 2010 LKB1 suppresses p21-activated kinase-1 (PAK1) by phosphorylation of Thr109 in the p21-binding domain.
20368693 2010 Endogenous LKB1 knockdown accelerates G(1)/S transition through p53 and p16 pathways.
20357370 2010 A single nucleotide polymorphism in STK11 influences insulin sensitivity and metformin efficacy in hyperinsulinemic girls with androgen excess.
20354225 2010 New roles for the LKB1-NUAK pathway in controlling myosin phosphatase complexes and cell adhesion.
20227367 2010 MicroRNA-451 regulates LKB1/AMPK signaling and allows adaptation to metabolic stress in glioma cells.
20207041 2010 Involvement of LKB1 in epithelial-mesenchymal transition (EMT) of human lung cancer cells.
20193846 2010 Homozygous deletion of the STK11/LKB1 locus and the generation of novel fusion transcripts in cervical cancer cells.
20082862 2010 LKB1 mutations are extremely rare in Korean non-small cell lung cancers.
20057966 2009 No association between promoter polymorphism of STK11 gene and lung cancer risk in the Korean population.
20020146 2010 Immunohistological evidence for Wnt-signaling activation in Peutz-Jeghers polyposis.
20018878 2010 Mechanism and role of high density lipoprotein-induced activation of AMP-activated protein kinase in endothelial cells.
20010869 2010 Enhanced activity of the CREB co-activator Crtc1 in LKB1 null lung cancer.
19908348 2009 Novel mutations in the STK11 gene in Thai patients with Peutz-Jeghers syndrome.
19892943 2009 Structure of the LKB1-STRAD-MO25 complex reveals an allosteric mechanism of kinase activation.
19727776 2010 Truncating mutations in Peutz-Jeghers syndrome are associated with more polyps, surgical interventions and cancers.
19724060 2009 Tumor suppression by LKB1: SIK-ness prevents metastasis.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19622832 2009 SIK1 couples LKB1 to p53-dependent anoikis and suppresses metastasis.
19615099 2009 Mutations in STK11 gene in Czech Peutz-Jeghers patients.
19584313 2009 LKB1 and AMPK family signaling: the intimate link between cell polarity and energy metabolism.
19520843 2009 Adiponectin activates AMP-activated protein kinase in muscle cells via APPL1/LKB1-dependent and phospholipase C/Ca2+/Ca2+/calmodulin-dependent protein kinase kinase-dependent pathways.
19513107 2009 ATP and MO25alpha regulate the conformational state of the STRADalpha pseudokinase and activation of the LKB1 tumour suppressor.
19507030 2010 A De Novo mutation of STK11 gene in a Chinese patient with Peutz-Jeghers syndrome.
19463221 2009 Pediatric juvenile polyposis syndromes: an update.
19414597 2009 Identification of the serine 307 of LKB1 as a novel phosphorylation site essential for its nucleocytoplasmic transport and endothelial cell angiogenesis.
19407487 2009 Inhibition of cervical cancer cell growth through activation of upstream kinases of AMP-activated protein kinase.
19386264 2009 Mst4 and Ezrin induce brush borders downstream of the Lkb1/Strad/Mo25 polarization complex.
19369417 2009 LKB1 catalytic activity contributes to estrogen receptor alpha signaling.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19351817 2009 Genetic mutations associated with cigarette smoking in pancreatic cancer.
19340305 2009 Somatic LKB1 mutations promote cervical cancer progression.
19287990 2009 Overexpression of the LKB1 gene inhibits lung carcinoma cell proliferation partly through degradation of c-myc protein.
19250387 2009 Two novel LKB1 mutations in Colombian Peutz-Jeghers syndrome patients.
19229701 2009 Somatic alterations of the serine/threonine kinase LKB1 gene in squamous cell (SCC) and large cell (LCC) lung carcinoma.
19204826 2009 The molecular mechanisms that underlie the tumor suppressor function of LKB1.
19177591 2009 Evidence for LKB1/AMP-activated protein kinase/ endothelial nitric oxide synthase cascade regulated by hepatocyte growth factor, S-adenosylmethionine, and nitric oxide in hepatocyte proliferation.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19165201 2009 LKB1/KRAS mutant lung cancers constitute a genetic subset of NSCLC with increased sensitivity to MAPK and mTOR signalling inhibition.
19145097 2008 Different phenotypes including gynecological cancer in three female patients with Peutz-Jeghers syndrome and mutations in the STK11 gene.
19068194 2008 [Effect of transfection of LKB1 on biological behavior of human lung adenocarcinoma cells].
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19029933 2008 LKB1; linking cell structure and tumor suppression.
18854318 2009 C-terminal phosphorylation of LKB1 is not required for regulation of AMP-activated protein kinase, BRSK1, BRSK2, or cell cycle arrest.
18854309 2009 Characterization of an alternative splice variant of LKB1.
18794113 2008 LKB1 is necessary for Akt-mediated phosphorylation of proapoptotic proteins.
18687677 2008 SIRT1 modulation of the acetylation status, cytosolic localization, and activity of LKB1. Possible role in AMP-activated protein kinase activation.
18681789 2008 Is pharmacogenomics our future? Metformin, ovulation and polymorphism of the STK11 gene in polycystic ovary syndrome.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18600394 2008 Molecular insights into Peutz-Jeghers syndrome: two probands with a germline mutation of LKB1.
18594528 2008 Mutations in the LKB1 tumour suppressor are frequently detected in tumours from Caucasian but not Asian lung cancer patients.
18495044 2008 A novel de novo mutation in the serine-threonine kinase STK11 gene in a Korean patient with Peutz-Jeghers syndrome.
18483235 2008 LKB1 and lung cancer: more than the usual suspects.
18403917 2008 LKB1 and AMPK and the regulation of skeletal muscle metabolism.
18321849 2008 Protein kinase Czeta-dependent LKB1 serine 428 phosphorylation increases LKB1 nucleus export and apoptosis in endothelial cells.
18311138 2008 LKB1 signaling in mesenchymal cells required for suppression of gastrointestinal polyposis.
18303014 2008 Rosiglitazone stimulates nitric oxide synthesis in human aortic endothelial cells via AMP-activated protein kinase.
18256292 2008 STRADalpha regulates LKB1 localization by blocking access to importin-alpha, and by association with Crm1 and exportin-7.
18245474 2008 The tumor suppressor LKB1 regulates lung cancer cell polarity by mediating cdc42 recruitment and activity.
18199157 2008 LKB1 protein expression in neuroendocrine tumors of the lung.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18000088 2008 Ovulatory response to treatment of polycystic ovary syndrome is associated with a polymorphism in the STK11 gene.
17950019 2008 Single nucleotide polymorphisms in genes encoding LKB1 (STK11), TORC2 (CRTC2) and AMPK alpha2-subunit (PRKAA2) and risk of type 2 diabetes.
17928927 2007 High-level expression of functional tumor suppressor LKB1 in Escherichia coli.
17921699 2007 Novel splice isoforms of STRADalpha differentially affect LKB1 activity, complex assembly and subcellular localization.
17884763 2007 [Effect of small interfering RNA-induced LKB1 gene silencing on the biological behavior of lung carcinoma cells].
17766436 2007 Suppression of oncogenic properties of c-Myc by LKB1-controlled epithelial organization.
17711506 2007 LKB1 gene mutations in Japanese lung cancer patients.
17676035 2007 LKB1 modulates lung cancer differentiation and metastasis.
17641416 2007 Deletions of N33, STK11 and TP53 are involved in the development of lymph node metastasis in larynx and pharynx carcinomas.
17637250 2007 Two novel STK11 mutations in three Chinese families with Peutz-Jeghers syndrome.
17599048 2007 A role for LKB1 gene in human cancer beyond the Peutz-Jeghers syndrome.
17575127 2007 LKB1 catalytically deficient mutants enhance cyclin D1 expression.
17573348 2007 Suppression of tubulin polymerization by the LKB1-microtubule-associated protein/microtubule affinity-regulating kinase signaling.
17384680 2007 Prevalence and specificity of LKB1 genetic alterations in lung cancers.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17344591 2007 [Sequence polymorphism of the promoter region of gene STK11 in patients with Peutz-Jeghers syndrome].
17319781 2007 STK11/LKB1 germline mutations in the first Peutz-Jeghers syndrome patients identified in Slovakia.
17244606 2007 Activation of lipoprotein lipase by glucose-dependent insulinotropic polypeptide in adipocytes. A role for a protein kinase B, LKB1, and AMP-activated protein kinase cascade.
17234589 2007 Activation of PAR-1 kinase and stimulation of tau phosphorylation by diverse signals require the tumor suppressor protein LKB1.
17216128 2007 Association of LKB1 with a WD-repeat protein WDR6 is implicated in cell growth arrest and p27(Kip1) induction.
17212587 2007 Interference with energy metabolism by 5-aminoimidazole-4-carboxamide-1-beta-D-ribofuranoside induces HPV suppression in cervical carcinoma cells and apoptosis in the absence of LKB1.
17114342 2006 Enhanced expression of LKB1 in breast cancer cells attenuates angiogenesis, invasion, and metastatic potential.
17108107 2006 LKB1 is recruited to the p21/WAF1 promoter by p53 to mediate transcriptional activation.
17098823 2007 Expression of an active LKB1 complex in cardiac myocytes results in decreased protein synthesis associated with phenylephrine-induced hypertrophy.
17026623 2006 An updated mutation spectrum in an Australian series of PJS patients provides further evidence for only one gene locus.
17010524 2007 The LKB1 tumor suppressor kinase in human disease.
16953221 2007 Dysfunctional AMPK activity, signalling through mTOR and survival in response to energetic stress in LKB1-deficient lung cancer.
16927138 2006 Peutz-Jeghers syndrome diagnosed in a schizophrenic patient with a large deletion in the STK11 gene.
16912160 2006 LKB1/STK11 suppresses cyclooxygenase-2 induction and cellular invasion through PEA3 in lung cancer.
16882735 2006 STK11 status and intussusception risk in Peutz-Jeghers syndrome.
16822578 2006 LKB1 mutation in large cell carcinoma of the lung.
16648371 2006 LKB1 exonic and whole gene deletions are a common cause of Peutz-Jeghers syndrome.
16582077 2006 Exonic STK11 deletions are not a rare cause of Peutz-Jeghers syndrome.
16580634 2006 The tumor suppressor LKB1 induces p21 expression in collaboration with LMO4, GATA-6, and Ldb1.
16540748 2006 The long QT syndrome family of cardiac ion channelopathies: a HuGE review.
16407837 2006 A novel mutation of STK11/LKB1 gene leads to the loss of cell growth inhibition in head and neck squamous cell carcinoma.
16407220 2006 Activation of protein kinase C zeta by peroxynitrite regulates LKB1-dependent AMP-activated protein kinase in cultured endothelial cells.
16396636 2006 The ubiquitin-associated domain of AMPK-related kinases regulates conformation and LKB1-mediated phosphorylation and activation.
16311241 2006 Reactive lipid species from cyclooxygenase-2 inactivate tumor suppressor LKB1/STK11: cyclopentenone prostaglandins and 4-hydroxy-2-nonenal covalently modify and inhibit the AMP-kinase kinase that modulates cellular energy homeostasis and protein translation.
16287113 2005 High proportion of large genomic STK11 deletions in Peutz-Jeghers syndrome.
16054041 2005 AMP-activated protein kinase: ancient energy gauge provides clues to modern understanding of metabolism.
15987703 2005 LKB1 interacts with and phosphorylates PTEN: a functional link between two proteins involved in cancer predisposing syndromes.
15800014 2005 Functional analysis of Peutz-Jeghers mutations reveals that the LKB1 C-terminal region exerts a crucial role in regulating both the AMPK pathway and the cell polarity.
15774015 2005 Sequence changes in predicted promoter elements of STK11/LKB1 are unlikely to contribute to Peutz-Jeghers syndrome.
15733851 2005 Identification of the sucrose non-fermenting related kinase SNRK, as a novel LKB1 substrate.
15731909 2005 Peutz-Jeghers LKB1 mutants fail to activate GSK-3beta, preventing it from inhibiting Wnt signaling.
15617552 2005 A novel STK11 germline mutation in two siblings with Peutz-Jeghers syndrome complicated by primary gastric cancer.
15608654 2005 An LKB1 AT-AC intron mutation causes Peutz-Jeghers syndrome via splicing at noncanonical cryptic splice sites.
15607222 2005 An efficient expression system for the production of functionally active human LKB1.
15561763 2004 Analysis of the LKB1-STRAD-MO25 complex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485651 2004 IGF-1 phosphorylates AMPK-alpha subunit in ATM-dependent and LKB1-independent manner.
15331174 2004 No evidence for germline mutations of the LKB1/STK11 gene in familial pancreatic carcinoma.
15292028 2004 Endurance training increases LKB1 and MO25 protein but not AMP-activated protein kinase kinase activity in skeletal muscle.
15287029 2004 Mapping of a translocation breakpoint in a Peutz-Jeghers hamartoma to the putative PJS locus at 19q13.4 and mutation analysis of candidate genes in polyp and STK11-negative PJS cases.
15231735 2004 Regulation of the TSC pathway by LKB1: evidence of a molecular link between tuberous sclerosis complex and Peutz-Jeghers syndrome.
15188174 2004 Relative frequency and morphology of cancers in STK11 mutation carriers.
15183188 2004 LKB1 tumor suppressor protein: PARtaker in cell polarity.
15121768 2004 Genotype-phenotype correlations in Peutz-Jeghers syndrome.
15077168 2004 Distinctive gene expression of human lung adenocarcinomas carrying LKB1 mutations.
15057824 2004 The DNA sequence and biology of human chromosome 19.
15021901 2004 Novel and natural knockout lung cancer cell lines for the LKB1/STK11 tumor suppressor gene.
15016379 2004 Complete polarization of single intestinal epithelial cells upon activation of LKB1 by STRAD.
14985505 2004 The tumor suppressor LKB1 kinase directly activates AMP-activated kinase and regulates apoptosis in response to energy stress.
14976552 2004 LKB1 is a master kinase that activates 13 kinases of the AMPK subfamily, including MARK/PAR-1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14676191 2004 Comprehensive proteomic analysis of human Par protein complexes reveals an interconnected protein network.
14668798 2003 Stability of the Peutz-Jeghers syndrome kinase LKB1 requires its binding to the molecular chaperones Hsp90/Cdc37.
14517248 2003 MO25alpha/beta interact with STRADalpha/beta enhancing their ability to bind, activate and localize LKB1 in the cytoplasm.
14517247 2003 MARKK, a Ste20-like kinase, activates the polarity-inducing kinase MARK/PAR-1.
14511408 Restoration of silenced Peutz-Jeghers syndrome gene, LKB1, induces apoptosis in pancreatic carcinoma cells.
14511394 2003 Complexes between the LKB1 tumor suppressor, STRAD alpha/beta and MO25 alpha/beta are upstream kinases in the AMP-activated protein kinase cascade.
12912948 2003 LKB1 protein expression in the evolution of glandular neoplasia of the lung.
12879020 2003 Regulation of the Wnt signalling component PAR1A by the Peutz-Jeghers syndrome kinase LKB1.
12847291 2003 Activation of yeast Snf1 and mammalian AMP-activated protein kinase by upstream kinases.
12805220 2003 Activation of the tumour suppressor kinase LKB1 by the STE20-like pseudokinase STRAD.
12753905 2003 The A20-binding protein ABIN-2 exerts unexpected function in mediating transcriptional coactivation.
12595760 An LKB1-interacting protein negatively regulates TNFalpha-induced NF-kappaB activation.
12552571 2003 Functional analysis of LKB1/STK11 mutants and two aberrant isoforms found in Peutz-Jeghers Syndrome patients.
12533684 2003 Mutations in the STK11 gene characterize minimal deviation adenocarcinoma of the uterine cervix.
12489981 2003 Heat-shock protein 90 and Cdc37 interact with LKB1 and regulate its stability.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12372054 2002 Mutation analysis of the STK11/LKB1 gene and clinical characteristics of an Australian series of Peutz-Jeghers syndrome patients.
12234250 2002 Ionizing radiation induces ataxia telangiectasia mutated kinase (ATM)-mediated phosphorylation of LKB1/STK11 at Thr-366.
12218179 2002 Induction of cyclooxygenase-2 in a mouse model of Peutz-Jeghers polyposis.
12097271 2002 Inactivation of LKB1/STK11 is a common event in adenocarcinomas of the lung.
11853558 2002 Identification and characterization of four novel phosphorylation sites (Ser31, Ser325, Thr336 and Thr366) on LKB1/STK11, the protein kinase mutated in Peutz-Jeghers cancer syndrome.
11741830 2001 LIP1, a cytoplasmic protein functionally linked to the Peutz-Jeghers syndrome kinase LKB1.
11445556 2001 LKB1 associates with Brg1 and is necessary for Brg1-induced growth arrest.
11430832 2001 The Peutz-Jegher gene product LKB1 is a mediator of p53-dependent cell death.
11297520 2001 Phosphorylation of the protein kinase mutated in Peutz-Jeghers cancer syndrome, LKB1/STK11, at Ser431 by p90(RSK) and cAMP-dependent protein kinase, but not its farnesylation at Cys(433), is essential for LKB1 to suppress cell vrowth.
11212897 2000 Frequent loss of heterozygosity at the 19p13.3 locus without LKB1/STK11 mutations in human carcinoma metastases to the brain.
10642527 2000 LKB1, a novel serine/threonine protein kinase and potential tumour suppressor, is phosphorylated by cAMP-dependent protein kinase (PKA) and prenylated in vivo.
10508479 1999 Antigens recognized by autologous antibody in patients with renal-cell carcinoma.
10429654 1999 Mutational analysis of STK11 gene in ovarian carcinomas.
10408777 1999 Novel mutations in the LKB1/STK11 gene in Dutch Peutz-Jeghers families.
10362809 1999 Germline and somatic mutations of the STK11/LKB1 Peutz-Jeghers gene in pancreatic and biliary cancers.
10208439 1999 Somatic mutation of the Peutz-Jeghers syndrome gene, LKB1/STK11, in malignant melanoma.
10201537 1999 Somatic mutations in the Peutz-Jeghers (LKB1/STKII) gene in sporadic malignant melanomas.
10079245 1999 LKB1 somatic mutations in sporadic tumors.
9887330 1999 Mutations and impaired function of LKB1 in familial and non-familial Peutz-Jeghers syndrome and a sporadic testicular cancer.
9837816 1998 Loss of LKB1 kinase activity in Peutz-Jeghers syndrome, and evidence for allelic and locus heterogeneity.
9809980 1998 STK11 mutations in Peutz-Jeghers syndrome and sporadic colon cancer.
9760200 1998 Nine novel germline mutations of STK11 in ten families with Peutz-Jeghers syndrome.
9731485 1998 Frequent somatic mutations in serine/threonine kinase 11/Peutz-Jeghers syndrome gene in left-sided colon cancer.
9683800 1998 Mutations of the STK11 gene in sporadic gastric carcinoma.
9605748 1998 Somatic mutations in LKB1 are rare in sporadic colorectal and testicular tumors.
9537235 1998 Low frequency of somatic mutations in the LKB1/Peutz-Jeghers syndrome gene in sporadic breast cancer.
9428765 1998 A serine/threonine kinase gene defective in Peutz-Jeghers syndrome.
9425897 1998 Peutz-Jeghers syndrome is caused by mutations in a novel serine threonine kinase.
8988175 1997 Localization of a susceptibility locus for Peutz-Jeghers syndrome to 19p using comparative genomic hybridization and targeted linkage analysis.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.