Property Summary

NCBI Gene PubMed Count 282
PubMed Score 617.81
PubTator Score 492.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -2.500 3.3e-05
osteosarcoma -1.387 4.0e-05
sonic hedgehog group medulloblastoma -1.200 3.3e-07
medulloblastoma, large-cell -1.400 2.3e-05

Protein-protein Interaction (5)

Gene RIF (247)

PMID Text
27069021 Sigma1 receptors attenuates STIM1 coupling to Orai1 and thereby inhibits SOCE.
26826124 T Cell Receptor-induced Nuclear Factor kappaB (NF-kappaB) Signaling and Transcriptional Activation Are Regulated by STIM1- and Orai1-mediated Calcium Entry.
26809794 STIM11-469 and Orai1 W76A mutants do not reduce channel open probability.
26775216 The abundance of mutated STIM1 and the MMP-2 expression were higher in native human umbilical vein endothelial cells of patients with gestational hypertension than controls and were significantly correlated with blood pressure.
26644574 Research on calcium signaling has centered on STIM1, ORAI1, and proteins that modulate their function. TMEM110 regulates the maintenance of ER-plasma membrane junctions and the short-term remodeling of junctions during store-dependent calcium signaling.
26643254 Studies suggest that STIM1 protein and calcium channel Orai1-mediated Ca2+ signaling are the potential target for cancer therapy.
26576490 We demonstrate that the Orai1/STIM1 channel is regulated by changes of both intracellular and extracellular pH.
26560041 study reports recessive STIM1 mutations in patients presenting with amelogenesis imperfecta and hypohidrosis without overt clinical immunodeficiency or myopathy
26546674 N and C-terminal domains of Orai1 synergistically contribute to the interaction with STIM1.
26543234 Data suggest that stromal interaction molecule 1 (STIM1) may be developed as a potential therapeutic target of cancer treatment.
26469693 The cellular dysfunction and clinical disease spectrum observed in mutant patients provide important information about the molecular regulation of ORAI1 and STIM1 proteins and the role of CRAC channels in human physiology.
26455959 Studies indicate that Ca(2+) sensor STIM1 and calcium channel Orai1 upregulation in cancer cells results in Ca2 + homeostasis remodeling and cell proliferation.
26454179 Results show the cytoplasmic domain of STIM1 as a target for calpains which cleave STIM1 to control its cellular abundance. Furthermore, STIM1's susceptibility to calpain cleavage leads to enhanced STIM1 degradation during the progression of apoptosis.
26453325 In c-kit+ cardiac progenitor cells, silencing STIM1 significantly reduced the Ca2+ signaling through store-operated Ca2+ channels, decreased cell proliferation and migration, and reduced expression of cyclin D1, cyclin E, and/or p-Akt.
26399906 STIM1 dimers undergo unimolecular coupling to activate and open Oari1 channels. The model predicts that STIM1 dimers may be involved in crosslinking between Orai1 channels with implications for the kinetics and localization of Orai1 channel opening.
26351694 Data indicate the interaction of a single calcium channel Orai1 channel with small clusters of stromal interaction molecule 1 (STIM1) molecules.
26322679 Data show that transmembrane protein 110 STIMATE is an endoplasmic reticulum (ER)-resident protein that co-localizes with membrane protein STIM1.
26257076 STIM1 also promoted cell migration and the epithelial-to-mesenchymal transition by activating TGF-beta, Snail and Wnt/beta-Catenin pathways.
26232624 data demonstrate that trafficking via fast recycling endosomes determines TRPC1-STIM1 clustering within ER-PM junctions following ER-Ca2+ store depletion which is critical for the surface expression and function of the channel.
26184105 STIM1 transmembrane region reorganization switches STIM1 cytosolic region into an extended conformation, thereby projecting the ORAI-activating domain to gate ORAI1 channels.
26166565 Results suggest a mutual dependency and regulation of STIM1 and HIF-1 in controlling Ca(2+) mobilization and hypoxic tumor growth.
26116575 STIM1-dependent Orai1 'trafficking trap' mechanism controls Orai1 plasma membrane enrichment and SOCE levels, thus modulating the SOCE 'bandwidth' for downstream signaling.
25953320 Functional investigation of a novel STIM1 mutation causing early-onset severe tubular aggregate myopathy showed increased store operated calcium entry (SOCE) in primary myoblasts
25935105 A novel hypomorphic mutation in STIM1 results in a late-onset immunodeficiency.
25918394 a loss-of-function STIM1 mutation (R429C) in human patients abolishes store-operated Ca(2+) entry
25915399 Study identifies STIM1 as a novel component of endoplasmic reticulum-Chlamydia trachomatis inclusion membrane contact sites.
25884983 These data suggest that store-operated Ca2+ entry, acting via STIM1, might be the predominant mechanism of Ca2+ entry in the modulation of endothelial cell permeability.
25840641 show the regulation of the IL-9-STIM1-ERK-IL-8 axis in keratinocyte, and how the axis might play an important role in the pathophysiology of atopic dermatitis
25832866 The antigrowth effect of STIM1 silencing was also discovered in FaDu hypopharyngeal tumor model.
25805497 STIM1/ORAI1-mediated Ca2+ influx regulates enolase-1 exteriorization in cancer cells.
25788524 Orai1 and STIM1 have roles in inhibiting matrix protein expression
25736291 STIM1L does not mediate rapid store-operated Ca(2+) entry but can trap and gate Orai1 channels efficiently without remodeling cortical ER cisternae.
25712868 these findings provide evidence for a new role of Homer1 supporting the regulation of Cav1.2 channels by STIM1.
25645930 The lipid raft scaffolding protein caveolin-1 interacts with the STIM1-Orai1 complex to increase channel activity.
25577287 York Platelet Syndrome patients have a chronic myopathy associated with rimmed vacuoles and heterozygous gain-of-function STIM1 mutations. Findings expand the phenotypic spectrum of STIM1-related human disorders and define the molecular basis of YPS.
25533457 Imin channels are regulated by STIM2, TRPC3-containing INS channels are induced by STIM1, and TRPC1-composed Imax channels are activated by both STIM1 and STIM2.
25531324 STIM1 promotes metastasis and is associated with cancer progression and poor prognosis in patients with colorectal cancer.
25517631 Translocation between PI(4,5)P2-poor and PI(4,5)P2-rich microdomains during calcium store depletion determines STIM1 conformation and Orai1 gating.
25447552 the increased vimentin expression and relocalization of E-cadherin triggered by EGF were largely inhibited by targeting STIM1 phosphorylation, while STIM1-S575E/S608E/S621E normalized the profiles of these two EMT markers
25404747 STIM1- and Orai1-mediated Ca(2+) oscillations promote melanoma invasion by orchestrating invadopodium assembly and extracellular matrix degradation.
25384971 SPPL3 enhances the signal-induced association of stromal interaction molecule 1
25381814 Implicated a role for COX-2 in STIM1-mediated CRC metastasis.
25342749 evidence of a sequential activation mechanism in the STIM1 cytosolic domains where the interaction between CC1 and CC3 segment regulates both SOAR/CAD exposure and CC3-mediated higher-order oligomerization
25296861 STIM1 gates the purified recombinant ORAI1 channel by eliciting a conformational change in the pore.
25190815 STIM1 and Orai1 have central roles in mediating Ca(2+) mobilization linked to inflammatory signaling of endothelial cells upon histamine stimulation
25088676 STIM1 modulates the subcellular location and function of TRPC6
25057023 STIM1-Orai1 complexes are trapped by their physical connections across the endoplasmic reticulum-plasma membrane junctions.
25044882 findings suggest that the p.R304W mutation impairs the function of STIM1 and may be the cause for Stormorken syndrome in the two families studied
25030742 It is a single-pass transmembrane protein located predominantly in the ER that serves as a Ca(2+) sensor within the ER. (review)
25016017 results support the proposal that cooperative signaling of both NF-kappaB and AP1 (via p38alpha) amplifies STIM1 expression in ECs and, thereby, contributes to the lung vascular hyperpermeability response during sepsis
25015419 Data indicate that calcium channel Orai1/stromal interaction molecule 1 protein STIM1 expression and function are increased in therapy resistant ovary carcinoma cells.
24996186 the nature of the interactions between STIM1 and Orai1
24957221 These findings suggest that STIM1 is involved in several ways in the reaction of muscle fibres to denervation
24845346 Members of the thrombospondin gene family bind stromal interaction molecule 1 and regulate calcium channel activity.
24842273 STIM1 may play an important role in the development of hepatocellular cancer
24811382 STIM1 is a key regulator of intracellular Ca(2) signaling in the mammalian nervous system.
24806964 STIM1 oligomerization did not rely on intact mitochondrial Ca(2+) uptake. However, MCU-dependent mitochondrial sequestration of Ca(2+) entering through the SOCE pathway was essential to prevent slow deactivation of SOCE
24755083 native store-operated Ca(2+) entry (SOCE) was blunted by inhibiting SOCE or by silencing Orai1 and STIM1.
24681268 STIM1 is a key protein involved in initiation of calcium flux and serving as a sensor of endoplasmic reticulum calcium levels. (Review)
24672054 KSR2 deficiency affects stromal interaction molecule 1 (STIM1)/ORAI1 puncta formation, which is correlated with cytoskeleton disorganization.
24621671 enamel maturation is dependent upon STIM1 and SLC24A4 function, and that there are important differences in the Ca(2+) transcellular transport systems used by secretory- and maturation-stage ameloblasts.
24619930 our data are compatible with a near-maximal activation of STIM1 in Stormorken syndrome patients. We conclude that the heterozygous mutation c.910C>T causes the complex phenotype that defines this syndrome.
24603752 The higher amplitude of store-operated Ca2+ entry was associated to the over-expression for Stim2, Orai2-3, and TRPC1 while Stim2 levels remained constant and Stim1, Orai1, Orai3, TRPC1 and TRPC4 proteins were over-expressed in primary myelofibrosis.
24591628 Activating mutations in STIM1 and ORAI1 cause overlapping syndromes of tubular myopathy and congenital miosis.
24583265 Orai1 and STIM1 mediate the store-operated calcium channels and contribute to apoptotic resistance of pancreatic adenocarcinoma.
24570283 In 3 patients with childhood onset tubular aggregate myopathy, STIM1 mutations were identified.
24556214 Data show that increased activity of STIM1-Orai1 complex inducing enhanced Ca(2+) influx is a disease determinant in muscular dystrophy.
24492416 While STIM1 is a full Orai1-agonist, leucine-replacement of this crucial residue in STIM2 endows it with partial agonist properties, which may be critical for limiting Orai1 activation stemming from its enhanced sensitivity to store-depletion
24489003 HIV-1 Tat modulates STIM1 expression in neuron cells
24464579 STIM1 Orai1-activating region domain of STIM1 interacts with the TRPC channel coiled coil domains and that this interaction is essential for opening the channels by STIM1.
24463606 STIM1 is transported by microtubule plus ends to the front.
24351972 store-operated calcium entry is activated through dynamic interplay between STIM1 and Orai1 helices
24308967 STIM1 may facilitate platelet activation by collagen through novel interactions at the plasma membrane while the essential Ca(2+)-sensing role of STIM1 is served by the protein in the Endoplasmic Reticulum.
24114840 E2 can signal nongenomically by inhibiting basal phosphorylation of STIM1, leading to a reduction in SOCE.
24109210 Activation of the endoplasmic reticulum STIM1 and store-operated calcium entry by rotavirus requires NSP4 viroporin activity.
24044355 Binding of the lysine rich domains of STIM1 and STIM2 to phosphatidylinositol 4,5 biphosphate rich liposomes depends on their oligomerization.
23994313 TRPA1 in cellular function is associated to the regulation of agonist-induced Ca(2+) entry by the modulation of STIM1/Orai1 interaction.
23943619 The major portion of the extended transmembrane Orai1 N-terminal region (aa76-90) is essential for STIM1 binding and Orai1 activation.
23871111 Upon depletion of the ER, STIM1 dissociates from EB1 and associates to APC.
23816623 Deletion of STIM1(448-490) and, in particular, STIM1(447-460) and STIM1(475-490) markedly enhances interaction of SARAF with STIM1.
23800047 Involvement of STIM1 and Orai1 in EGF-mediated cell growth in retinal pigment epithelial cells
23798062 Data indicate that the The endoplasmic reticulum-resident calcium (Ca2+) sensor stromal interacton molecule 1 (STIM1) is intimately involved in the cellular response to thrombin.
23714431 STIM1 may play an important role in the development of non-small cell lung cancer
23713409 Cytokines induce a constitutive increase in STIM1 aggregation.
23700407 Human dendritic cell maturation and cytokine secretions depend on store operated calcium entry signaling involving STIM1 and Orai1 proteins.
23698468 HDAC6 inhibition did not affect interactions between STIM1 and the microtubule plus end-binding protein EB1.
23690558 The key components and actions of STIM1 that underlie the activation of the arachidonate-regulated calcium channels are reported.
23687376 phosphorylation of STIM1 at Ser575, Ser608 and Ser621 regulates the interaction with EB1.
23668188 results suggest that STIM1 negatively regulates Ca(2) release from the SR through the direct interaction of the STIM1 C-terminus with DHPR, and that STIM1 is involved in both ECC and SOCE in skeletal muscle
23625915 inhibition of the SOCE downstream target CaM kinase kinase beta (CaMKKbeta) or knockdown of AMPKalpha1 suppressed PAR-1-mediated phosphorylation of p38beta and hence STIM1.
23578185 STIM1 protein was expressed in U251, U87 and U373 cells, and especially higher in U251 cells. RNA interference efficiently downregulated the expression of STIM1 in U251 cells at both mRNA and protein levels.
23572507 Mutational analyses reveal that electrostatic interactions between the predicted first and third coiled-coil domains of STIM1 are not involved in maintaining the 'closed' inactive conformation
23515871 STIM1 knockdown significantly decreased invasive capabilities of glioblastoma cells.
23512989 Data indicate that endothelial cells required the endoplasmic reticulum-localized, calcium-sensing protein stromal interacting molecule 1 (STIM1), but was independent of the Ca2+ release-activated Ca2+ channel protein Orai1.
23512987 Data indicate that STIM1 plays its role within the thrombin signaling independently of store-operated Ca2+ entry (SOCE) through Orai channels as a signaling component linking the thrombin receptor to RhoA activation and stress fiber formation.
23447534 a stepwise gating mechanism of STIM1-operated Orai1 channels; the initial binding between STIM1 and the C terminus of Orai1 docks STIM1 onto the N terminus of Orai1 to initiate conformational changes
23395841 A functional role of plasma membrane-resident STIM1 is in the regulation of store-operated divalent cation entry, which at least involves the EF-hand motif and the C-terminal polybasic lysine-rich domain.
23378028 Results highlight the unique role of STIM1-dependent Ca(2+) signaling in controlling cell migration by the regulation of actomyosin reorganization in conjunction with enhanced contractile forces.
23332920 A tight regulation of STIM1-dependent store-operated Ca(2+) entry is fundamental for normal skeletal-muscle structure and function.
23320111 STIM1 consists of various domains that are involved in divalent calcium-ion sensing, oligomerization, and channel activation. Domains and boundaries are identified in which functional and stable recombinant STIM1 can be produced in large quantities.
23272049 stromal interaction molecule 1 has a role in erythrocyte sedimentation and C-reactive protein activity in HLA-B27 positive ankylosing spondylitis patients
23212906 The molecular kinetics of STIM1 and Orai1 are major determinants of calcium influx in cultured cell.
23203809 By directing cellular localization of TRPC1 and AQP5 channels and by selectively regulating the functional assembly TRPC1-STIM1 channels, Cav1 is a crucial determinant of SG fluid secretion.
23203806 STIM1 or Orai1 suppressed normal growth of HaCaT cells in low Ca(2+) and inhibited the growth arrest in response to a Ca(2+) switch. These results demonstrate that SOCE plays multiple crucial roles in KC differentiation and function.
23184982 Orai-STIM-mediated Ca2+ release from secretory granules revealed by a targeted Ca2+ and pH probe
23108404 mTORC1 enhancement of store-operated Ca(2+) signaling hinders TSC-related tumor growth through suppression of AKT1 signaling. The augmented SOCE by hyperactive mTORC1-STIM1 cascade may contribute to the benign nature of TSC-related tumors.
23068106 These results suggest that the higher binding capacity of STIM1L to SOCCs and ROCCs plays an important role in the regulation of Ca(2+) signaling such as the augmentation of SOCE via Orai1 and the inhibition of ROCE via TRPC3 and TRPC6.
23049826 F-actin polymerization disruption by Cytochalasin D in neuroendocrine-differentiated cells restores store-operated calcium entry, while induction by jasplakinolide or calyculin A diminishes SOCE without changing the expression of Orai1, STIM1, and TRPC1
23043102 Orai1 and PLA2g6 are involved in adhesion formation, whereas STIM1 participates in both adhesion formation and disassembly.
23022228 results indicate that STIM1 plays an important role in SOCE, cell-growth and tumorigenicity in human epidermoid carcinoma A431cells, suggesting the potential use of STIM1-targeting agents for treating epidermoid carcinoma
22984609 Data suggest that STIM1 could be an important molecule responsible for airway remodeling.
22914293 Studies indicate that in vertebrates, stromal interaction molecule proteins STIM1 and STIM2 are expressed ubiquitously throughout cell types.
22842488 ER Ca(2+) store-independent mechanism for STIM1 clustering is a new alternative mechanism for regulating store-operated channel activity, which could act as a new pharmacological target
22748319 STIM1 phosphorylation is a major regulatory mechanism that excludes endoplasmic reticulum from the mitotic spindle.
22592407 It was shown that polyamines regulate intestinal epithelial restitution through TRPC1-mediated Ca2+ signaling by altering the ratio of STIM1 to STIM2. Overexpression of ornithine decarboxylase resulted in increased STIM1 but decreased STIM2 expression.
22586105 Data show that junctate (ASPH) is an interacting partner of Orai1-STIM1 complex.
22549787 Variation of expression levels of Orai1 or STIM1 can significantly alter expression and role of some endogenous regulators of store operated calcium entry.
22498042 STIM1 does not contain a di-lysine ER-retention signal
22451904 Functional studies suggest that the inhibitory helix may keep the C-terminus of STIM1 in an inactive state.
22438918 STIM1 exists in an oligomeric form in resting cells and that rather than the SAM motif, it is the C-terminus (residues 233-474) of STIM1 that is the key domain for the interaction between STIM1s.
22387225 STIM1 tyrosine phosphorylation is required for STIM1/Orai1 interaction during store-operated Ca(2+) entry mechanism (SOCE) activation.
22384096 intracellular alkalinization inhibits SERCA activity, activating store-operated channels (SOCs) of Orai1 and Stim1, leading to increased Ca(2+) influx
22381755 The apoptosis of human colon cancer cells induced by sodium butyrate is correlated to the redistribution of STIM1 and Orai1.
22298778 STIM1 translocation can consequently occur independently of Orai1 clustering and SOCE.
22278058 results demonstrate that STIM1-mediated gating of CRAC channels occurs through an unusual mechanism in which permeation and gating are closely coupled
22260675 The thin cortical endoplasmic reticulum (ER) consists of thinner sections of the cortical ER enriched in STIM1 and devoid of chaperones that appear to be specialized ER compartments dedicated to Ca2+ signalling.
22246182 The authors provide data revealing both functional and physical links between the activation of stromal interacting molecule 1 (STIM1) and PMCA-mediated Ca(2+) clearance.
22110130 powerful genomic regulation of Orai1/STIM1 by SGK1-dependent NF-kappaB signaling.
22031597 Data present a novel pathway for the regulation of Ca(2+) signaling and PASMC proliferation involving activation of Akt/mTOR and upregulation of STIM1/Orai1.
21956116 HIV-1 Tat modulates STIM1 expression in neuron cells
21906591 Stim1 and Stim2 were increased in brains of chronic epileptic rodents and strongly expressed in hippocampal specimens from medial temporal lobe epilepsy patients.
21880734 the refilling of ER Ca(2+) stores is not sufficient to induce STIM1 de-oligomerization and that localized Ca(2+) elevations in the vicinity of assembled SOCE complexes are required for the termination of SOCE.
21876174 STIM1-dependent signaling is important for cervical cancer cell proliferation, migration, and angiogenesis.
21790973 STIM1-deficient patients suffer from severe immunodeficiency, congenital myopathy, chronic pulmonary disease, anhydrotic ectodermal dysplasia, defective dental enamel calcification and autoimmune disorders. (Review)
21788372 STIM1L was expressed in several mammalian tissues, suggesting that many cell types rely on this Ca(2+) sensor for their Ca(2+) homeostasis and intracellular signaling
21724845 the N-terminal conserved region plays a multifaceted role in Orai3 current gating with distinct structural requirements for STIM1- and 2-APB-stimulated activation.
21640715 The cytoskeleton plays a relevant role in the regulation of store-operated calcium entry in the plasma membrane via regulation of the interaction between STIM1 and Orai1 or transient receptor potential cation channel (TRPC1).
21540881 The short STIM1 SOAR/CAD domain (STIM1 Orai1-activating region/CRAC-activating domain), which has two coiledcoil (C-C) domains, interacts with the Orai1 C terminus C-C domain to activate the store-operated Ca(2+) channels in the endoplasmic reticulum.
21499266 temperature is an important regulator of STIM1 function.
21432868 Results indicate that androgens modulate [Ca2+]i through the direct regulation of the STIM1 gene by AR binding to the STIM1 promoter.
21427704 STIM1 couples to ORAI1 via an intramolecular transition into an extended conformation.
21321120 STIM1 and STIM2 are located in the acidic Ca2+ stores and associates with Orai1 upon depletion of the acidic stores in human platelets.
21255618 Lipid raft domains are essential for the inactivation of store-operated Ca(2)+ entry by extracellular Ca(2)+ mediated by the interaction between plasma membrane-located STIM1 and Orai1.
21239714 FcgammaR-mediated phagocytosis of neutrophils requires the complex formed by S100 calcium-binding protein-A8 and -A9 as the site of interplay between extracellular calcium entry and intraphagosomal reactive oxygen species production.
21220431 STIM1 clustering inhibition during meiosis is independent of the C-terminal 200 residues.
21220420 Mitofusin 2 regulates STIM1 migration from the Ca2+ store to the plasma membrane in cells with depolarized mitochondria.
21217057 Data suggest that divergent Ca(2+)- and SAM-dependent stabilization of the EF-SAM fold contributes to the disparate regulation of store-operated Ca(2+) entry by STIM1 and STIM2.
21193399 channels bound to STIM1 resist 2-APB gating, whereas 2-APB antagonizes STIM1 gating.
21126331 Taken together, these data demonstrate a potentially important role for NCX1 in control of Ca2+ homeostasis and link store depletion via STIM1 directly with NCX activation.
21081754 evolutionarily conserved mechanism of STIM1 activation resembles the regulation of protein kinases by intramolecular silencing through pseudosubstrate binding
20976103 surface STIM1 levels and thapsigargin (TG)-induced SOCE are significantly increased in cells treated with proteasome inhibitors
20929812 study found that STIM1 suppresses depolarization-induced opening of the voltage-gated Ca(2+) channel Ca(V)1.2; STIM1 binds to the C terminus of Ca(V)1.2, inhibits gating and causes long-term internalization of the channel from the membrane
20926378 TRPC channels can function as STIM1-dependent and STIM1-independent channels, which increases the versatility of TRPC channel function and their role in receptor-stimulated Ca(2+) influx.
20876309 STIM1 T cell deficiency precipitated the development of lethal KS in this child upon infection with HHV-8.
20808796 novel polycystin-1 cleavage product, P100, which functions to reduce store operated Ca(2+) entry via direct inhibition of STIM1
20736304 Phosphorylation of STIM1 by ERK1/2 modulates store-operated calcium entry.
20679432 The STIM1 is S-glutathionylated at cysteine 56 in response to oxidant stress and evokes constitutive Ca(2+) entry independent of intracellular Ca(2+) stores.
20629634 Data show that Golli interacts with the C-terminal domain of STIM1 in both in vitro and in vivo binding assays and this interaction may be modulated by the intracellular Ca(2+) concentration.
20587595 Observations indicate that mitochondrial Ca2+ uptake, including reversal of NCXmito, is fundamental for STIM1-Orai1-dependent SOCE, whereas the proximity of mitochondria to STIM1-Orai1 SOCE units and their motility is not required.
20534587 Co-expression of STIM1 and Orai1 was shown to dramatically enhance CRAC channel currents while maintaining most if not all properties characteristic of native CRAC channels.
20436167 STIM2 is a necessary partner of STIM1 for excitation-contraction coupling.
20375143 Data show that STIM1 cytosolic domains play distinct roles in forming both "resting" oligomers in cells with replete Ca(2+) stores and higher-order oligomers in store-depleted cells.
20194530 STIM1 is the generally expressed genes in normal and adenomatous human parathyroids.
20073506 A short, highly conserved basic sequence within STIM1 channel-activating domain (residues 382-387) interacts directly with calcium modulator Orai1 to gate the influx of intracellular divalent calcium ions (Ca2+) in eukaryotic cells.
19906989 a detailed ultrastructural description of the ER remodeling induced by STIM1 was provided.
19897728 Results suggest that activation of TRPC1-SOC by STIM1 mediates release of the channel from caveolin-1.
19881501 found that STIM1 from mitotic cells is recognized by the phospho-specific MPM-2 antibody, suggesting that STIM1 is phosphorylated during mitosis.
19843011 Data support the idea that phosphoinositides are not essential but contribute to STIM1 accumulation at ER-PM junctions with a second translocation mechanism involving direct STIM1-Orai interactions.
19765994 STIM1 is involved in calcium entry during calcium oscillations.
19754898 Lack of STIM1 or ORAI1 in human patients and mice strongly compromises T cell function[review]
19706554 Data show that fast Ca(2+)-dependent inactivation of the Orais requires a domain of STIM1.
19694801 D to A mutations at Ca(2+)-coordinating loop positions 1 and 3 of the EF-hand from STIM1 led to a 15-fold decrease in the metal-binding affinity
19631699 plasma membrane-located STIM1 is important for the inactivation of SOCE by extracellular Ca(2+), an event that is likely to be mediated by interaction with Orai1
19626660 STIM1 plays role in PAR1-mediated Ca2+ influx in endothelial cells; DNA sequence alignment of human and porcine STIM1
19622747 the Ca2(+ )release-activated Ca2(+) (CRAC) modulatory domain (CMD) within STIM1 mediates fast Ca2(+)-dependent inactivation of ORAI1 channels
19506081 analysis of activation of Orai1-3 channels by a STIM1 coiled-coil mutant
19487696 Results show that the 55-amino-acid STIM2 terminus substituted within STIM1 strikingly enhances both Orai1-mediated Ca(2+) entry and constitutive coupling to activate Orai1 channels.
19447651 expression of TRPC3, Orai1 and STIM1 is enhanced in DM2 subjects as compared to controls
19433064 results provide evidence for a role of STIM1 protein in the control of Ca2+ influx in neutrophils excluding a STIM2 involvement in this process
19433061 these findings suggest that CCb9 represents a minimal ORAI1 activation domain within STIM1 that is masked by an adjacent 31 amino acid peptide preventing efficient CRAC channel activation in cells with replete Ca(2+) stores.
19429662 Suggest that Orai1, together with STIM1, plays a critical role in Pb(2+) entry and the toxicity of Pb(2+).
19420366 study reports 3 siblings from 1 kindred with a syndrome of immunodeficiency, hepatosplenomegaly, autoimmune hemolytic anemia, thrombocytopenia, muscular hypotonia & defective enamel dentition; 2 of the patients have homozygous nonsense mutation in STIM1
19403622 suggest that several key properties of Ca2+ channels formed by Orai1 depend on its interaction with STIM1
19332491 TRPC channels appear to be activated by mechanisms dependent on phospholipase C which do not involve the Ca(2+) sensor, STIM1.
19327826 Data show that SERCA2 associates slowly with STIM1, after the later forms puncta at the endoplasmic reticulum.
19307462 TRPC1/TRPC4 complexes constitute the functional subunits of SOC and that the interaction between STIM1 and TRPC4 may be the mechanism for the activation of the channels.
19287379 The existence of a pathway (store-operated cAMP signalling or SOcAMPS) in which the content of internal Ca(2+) stores is directly connected to cAMP signalling through a process that involves STIM1, is proposed.
19272522 Stim1-mediated Ca(2+) entry negatively regulates adipocyte differentiation
19260825 Findings support the hypothesis that hTRPC6 participates both in CCE and NCCE through its interaction with the Orai1-STIM1 complex or hTRPC3 respectively.
19249086 Studies establish a molecular mechanism for store-operated Ca(2+) entry in which the direct binding of STIM1 to Orai1 drives the accumulation and the activation of Ca2+ release-activated Ca2+ channels at endoplasmic reticulum-plasma membrane junctions.
19189966 two cytosolic key regions within STIM1 C terminus that control ORAI1/CRAC activation: a homomerization domain indispensable for coupling to ORAI1 and a modulatory domain that controls the extent of coupling to ORAI1.
19185847 Data demonstrate a role for Orai1 and STIM1 in tumor metastasis and suggest store-operated calcium entry channels as potential cancer therapeutic targets.
19182790 The characteristic inward rectification of Orai is mediated by an interaction between the polybasic STIM1 (672-685) and a Pro-rich region in the N terminus of Orai1.
19171672 An integral component of the adenosine cyclic monophosphate cyclic AMP and capacitative divalent calcium ion (Ca2+) entry microdomain associated with adenylyl cyclase 8
19111578 Data demonstrate that cellular levels of STIM1 and STIM2, which are key players in capacitative Ca2+ entry, depend on presenilins.
19107116 STIM1 appears as a major regulator of in vitro and in vivo vascular smooth muscle cell proliferation, representing a novel and original pharmacological target for prominent vascular proliferative diseases
19088073 STIM1 and Orai1 are key molecules for the induction of human myoblast differentiation
19052075 Results suggest STIM1 has a critical role in neointimal formation in a rat model of vascular injury.
19019825 distinct oligomerization dynamics of STIM isoforms have evolved to adapt to differential roles in Ca(2+) homeostasis and signaling
18995841 STIM1 gates TRPC1 by intermolecular electrostatic interaction.
18854159 Structurally critical mutations in the canonical EF-hand, "hidden" EF-hand, or SAM domain disrupt Ca2+ sensitivity in oligomerization via destabilization of the entire EF-SAM entity.
18845811 Knockdown of Stim1 inhibits endothelial proliferation and causes cell cycle arrest at S and G2/M phase.
18843204 TRPC1, Orai1 and STIM1 form a heteromultimer associated with lipid raft domains and regulated by the intracellular Ca2+ stores
18832420 identify a STIM1-dependent conformational change in Orai1 during the activation of CRAC channels
18802022 Report interactions, functions, and independence of plasma membrane STIM1 and TRPC1 in vascular smooth muscle cells.
18778263 Dynamic imaging of calcium and STIM1 in the same cell using wide-field TIRF microscopy is reported.
18768920 Data challenge the idea of direct conformational coupling between STIM1 and Orai1 as a viable mechanism of puncta formation and SOCE activation and uncover greater complexity in their relationship.
18644792 the STIM1-Orai1-hTRPC1 complex has a role in the activation of store-operated Ca(2+) entry
18635545 plasma membrane STIM1 may play a regulatory role in store-operated channel activation
18569867 evidence for STIM1:Orai1 as a primary pathway for agonist-evoked Ca2+ influx in the platelet and megakaryocyte.
18542992 ATP depletion induces translocation of STIM1 to puncta and formation of STIM1-ORAI1 clusters: translocation and re-translocation of STIM1 does not require ATP.
18506892 Huh-7 and HepG2 cells (hepatoma cell lines) express transient receptor potential canonical 1 (TRPC1) and TRPC6, as well as STIM1 and Orai1, and these 4 channels are the most likely candidates to account for the store-operated calcium entry in these cells.
18448669 analysis of movement of the calcium sensor STIM1 and the calcium channel Orai1 in activated T-cells
18430726 intact lipid raft domains determine targeting of STIM1 clusters to ER-plasma membrane junctions following store depletion which facilitates the functional interaction of STIM1 with TRPC1 and activation of store-operated Ca(2+) entry
18420269 Data show that STIM1 and TRPC1 interact and insert TRPC1 into lipid rafts, where TRPC1 functions as a store-operated channel; in the absence of STIM1, TRPC1 associates with other members from the TRPC family of channels to form receptor-operated channels.
18403424 The effects of 2-aminoethoxydiphenyl borate on orai1, orai2, orai3 metabolism in HEK293 cells with and without STIM1 are reported.
18337467 Soft substrate up-regulates the interaction of STIM1 with store-operated Ca(2+) channels, which results in the activation of mu-calpain and subsequently induces normal epithelial cell apoptosis.
18326500 demonstrate a functional requirement for Orai1 in TRPC1+STIM1-dependent SOCE
18250319 results imply a positive feedback loop in which an initial TCR signal favors up-regulation of STIM1 and Orai proteins that would augment Ca2+ signaling during subsequent antigen encounter
18249114 STIM1 directly binds to the microtubule-plus-end-tracking protein EB1 and forms EB1-dependent comet-like accumulations at the sites where polymerizing microtubule ends come in contact with the ER network.
18190941 Orai1-STIM1 protein complex is one of the molecular components involved in Pb2+ entry.
18187424 C-terminal coiled-coil motif of ORAI1 represents a key domain for dynamic coupling to STIM1.
18166150 Our biophysical studies reveal a structural stability difference in the EF-SAM region between STIM1 and STIM2, which may account for their different biological functions.
17925382 Data suggest that microtubules play a facilitative role in the store-operated Ca(2+) entry signaling pathway by optimizing the localization of STIM1.
17702753 the interacting domains of STIM1 and Orai1 have roles in Ca2+ release-activated Ca2+ channel activation
17684017 analysis of the plasma membrane-endoplasmic reticulum contact sites reveals the presence of additional molecular components within the STIM1-Orai1 Complex
17517596 STIM1 oligomers translocate on average only 2 mum to reach endoplasmic reticulum-plasma membrane junctions
17486119 We propose a new definition of SOCs, as channels that are regulated by STIM1 and require the store depletion-mediated clustering of STIM1. By this definition, all TRPC channels, except TRPC7, function as SOCs.
17360414 analysis of STIM1 surface exposure by fluorescent imaging with a hexahistidine-Zn2+-dye
17299780 LPA and UTP may exert distinct effects on the duration of STIM1 localization at the plasma membrane, and thus, on the magnitude and duration of agonist-induced calcium entry
17298947 peripheral STIM1 relocalization that is causal in regulation of SOCE is determined by the status of [Ca(2+)] in the ER in close proximity to the plasma membrane
17283081 endoplasmic reticulum refilling is largely preserved at reduced STIM1 levels
17224452 dynamic assembly of TRPC1-STIM1-Orai1 ternary complex is involved in activation of SOC channel in response to internal Ca2+ store depletion
17218358 Ca2+ entry supporting [Ca2+]i oscillations in HEK293 cells depends upon the Ca2+ sensor, Stim1, and calcium release-activated Ca2+ channel protein, Orai1
17158173 in contrast to store-operated channels, regulation of ARC channels by STIM1 depends exclusively on the pool of STIM1 constitutively residing in the plasma membrane
17045966 Therefore, we propose that store depletion causes aggregation and translocation of STIM1 in close apposition to the plasma membrane.
17020874 STIM1 has a role as an Endoplasmic Reticulum Ca2+ sensor
16987424 STIM1 acts as a key signal for store operated calcium channel activation in human airway myocytes.
16966422 These studies identify an ER structure underlying store-operated Ca(2+) entry, whose extreme proximity to the PM may enable STIM1 to interact with CRAC channels or associated proteins.
16906149 STIM1 is a key regulator of activity rather than a channel component, and reveal similar regulation of SOC, I(crac) and TRPC channel activation by STIM1.
16870612 Interaction of STIM1 with endogenously expressed human canonical TRP1 upon depletion of intracellular Ca2+ stores.
16860747 STIM1 is a required mediator of store-operated channel (SOC) activation and plays a coordinated role with STIM2 in controlling SOC-mediated Ca(2+) entry signals.
16766533 suppression of store-operated channels function by Orai1 overexpression likely reflects a required stoichiometry between STIM1 and Orai1
16733527 STIM1 and CRACM1 interact functionally. Overexpression of both proteins greatly potentiates I(CRAC), suggesting that STIM1 and CRACM1 mutually limit store-operated currents and that CRACM1 may be the long-sought CRAC channel.
16537481 Increased expression levels of STIM1 correlate with a gain in function of Ca(2+) release-activated Ca(2+) (CRAC) channel activity.
16005298 STIM proteins function as Ca(2+) store sensors in the signaling pathway connecting Ca(2+) store depletion to Ca(2+) influx.
14582397 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

MDVCVRLALWLLWGLLLHQGQSLSHSHSEKATGTSSGANSEESTAAEFCRIDKPLCHSEDEKLSFEAVRN      1 - 70
IHKLMDDDANGDVDVEESDEFLREDLNYHDPTVKHSTFHGEDKLISVEDLWKAWKSSEVYNWTVDEVVQW     71 - 140
LITYVELPQYEETFRKLQLSGHAMPRLAVTNTTMTGTVLKMTDRSHRQKLQLKALDTVLFGPPLLTRHNH    141 - 210
LKDFMLVVSIVIGVGGCWFAYIQNRYSKEHMKKMMKDLEGLHRAEQSLHDLQERLHKAQEEHRTVEVEKV    211 - 280
HLEKKLRDEINLAKQEAQRLKELREGTENERSRQKYAEEELEQVREALRKAEKELESHSSWYAPEALQKW    281 - 350
LQLTHEVEVQYYNIKKQNAEKQLLVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILTAKQALSEVT    351 - 420
AALRERLHRWQQIEILCGFQIVNNPGIHSLVAALNIDPSWMGSTRPNPAHFIMTDDVDDMDEEIVSPLSM    421 - 490
QSPSLQSSVRQRLTEPQHGLGSQRDLTHSDSESSLHMSDRQRVAPKPPQMSRAADEALNAMTSNGSHRLI    491 - 560
EGVHPGSLVEKLPDSPALAKKALLALNHGLDKAHSLMELSPSAPPGGSPHLDSSRSHSPSSPDPDTPSPV    561 - 630
GDSRALQASRNTRIPHLAGKKAVAEEDNGSIGEETDSSPGRKKFPLKIFKKPLKK                   631 - 685
//

Text Mined References (297)

PMID Year Title
27069021 2016 Sigma1 receptors inhibit store-operated Ca2+ entry by attenuating coupling of STIM1 to Orai1.
26826124 2016 T Cell Receptor-induced Nuclear Factor ?B (NF-?B) Signaling and Transcriptional Activation Are Regulated by STIM1- and Orai1-mediated Calcium Entry.
26809794 2016 The inactivation domain of STIM1 is functionally coupled with the Orai1 pore to enable Ca2+-dependent inactivation.
26775216 2016 A stromal interaction molecule 1 variant up-regulates matrix metalloproteinase-2 expression by strengthening nucleoplasmic Ca2+ signaling.
26644574 2015 TMEM110 regulates the maintenance and remodeling of mammalian ER-plasma membrane junctions competent for STIM-ORAI signaling.
26643254 2016 The store-operated Ca(2+) entry-mediated signaling is important for cancer spread.
26576490 2015 Identification of key amino acid residues responsible for internal and external pH sensitivity of Orai1/STIM1 channels.
26560041 2016 A homozygous STIM1 mutation impairs store-operated calcium entry and natural killer cell effector function without clinical immunodeficiency.
26546674 2016 Cooperative Binding of Stromal Interaction Molecule 1 (STIM1) to the N and C Termini of Calcium Release-activated Calcium Modulator 1 (Orai1).
26543234 2015 Correlation of clinical features and genetic profiles of stromal interaction molecule 1 (STIM1) in colorectal cancers.
26469693 2015 Diseases caused by mutations in ORAI1 and STIM1.
26455959 2016 STIM and calcium channel complexes in cancer.
26454179 2015 STIM1 is cleaved by calpain.
26453325 2015 Roles of store-operated Ca2+ channels in regulating cell cycling and migration of human cardiac c-kit+ progenitor cells.
26399906 2015 STIM1 dimers undergo unimolecular coupling to activate Orai1 channels.
26351694 2015 Nanoscale patterning of STIM1 and Orai1 during store-operated Ca2+ entry.
26322679 2015 Proteomic mapping of ER-PM junctions identifies STIMATE as a regulator of Ca²? influx.
26257076 2015 STIM1 accelerates cell senescence in a remodeled microenvironment but enhances the epithelial-to-mesenchymal transition in prostate cancer.
26232624 2015 Fast endocytic recycling determines TRPC1-STIM1 clustering in ER-PM junctions and plasma membrane function of the channel.
26184105 2015 Inside-out Ca(2+) signalling prompted by STIM1 conformational switch.
26166565 2015 STIM1 Mediates Hypoxia-Driven Hepatocarcinogenesis via Interaction with HIF-1.
26116575 2015 A STIM1-dependent 'trafficking trap' mechanism regulates Orai1 plasma membrane residence and Ca²? influx levels.
25996873 2015 TMEM203 Is a Novel Regulator of Intracellular Calcium Homeostasis and Is Required for Spermatogenesis.
25953320 2015 50 years to diagnosis: Autosomal dominant tubular aggregate myopathy caused by a novel STIM1 mutation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25935105 2015 A novel hypomorphic mutation in STIM1 results in a late-onset immunodeficiency.
25918394 2015 Missense mutation in immunodeficient patients shows the multifunctional roles of coiled-coil domain 3 (CC3) in STIM1 activation.
25915399 2015 STIM1 Is a Novel Component of ER-Chlamydia trachomatis Inclusion Membrane Contact Sites.
25884983 2015 Store-operated Ca2+ entry plays a role in HMGB1-induced vascular endothelial cell hyperpermeability.
25840641 2015 IL-9 induces IL-8 production via STIM1 activation and ERK phosphorylation in epidermal keratinocytes: A plausible mechanism of IL-9R in atopic dermatitis.
25832866 2015 Stromal interaction molecule 1 (STIM1) silencing inhibits tumor growth and promotes cell cycle arrest and apoptosis in hypopharyngeal carcinoma.
25805497 2015 STIM1/ORAI1-mediated Ca2+ Influx Regulates Enolase-1 Exteriorization.
25788524 2015 Store-Operated Ca2+ Channels in Mesangial Cells Inhibit Matrix Protein Expression.
25736291 2015 STIM1L traps and gates Orai1 channels without remodeling the cortical ER.
25712868 2015 Homer proteins mediate the interaction between STIM1 and Cav1.2 channels.
25645930 2015 Distinct structural domains of caveolin-1 independently regulate Ca2+ release-activated Ca2+ channels and Ca2+ microdomain-dependent gene expression.
25577287 2015 York platelet syndrome is a CRAC channelopathy due to gain-of-function mutations in STIM1.
25533457 2015 STIM1 and STIM2 proteins differently regulate endogenous store-operated channels in HEK293 cells.
25531324 2015 STIM1, a direct target of microRNA-185, promotes tumor metastasis and is associated with poor prognosis in colorectal cancer.
25517631 2014 Translocation between PI(4,5)P2-poor and PI(4,5)P2-rich microdomains during store depletion determines STIM1 conformation and Orai1 gating.
25447552 2015 STIM1 phosphorylation triggered by epidermal growth factor mediates cell migration.
25404747 2014 STIM1- and Orai1-mediated Ca(2+) oscillation orchestrates invadopodium formation and melanoma invasion.
25384971 2015 A protease-independent function for SPPL3 in NFAT activation.
25381814 2015 STIM1 overexpression promotes colorectal cancer progression, cell motility and COX-2 expression.
25342749 2014 A coiled-coil clamp controls both conformation and clustering of stromal interaction molecule 1 (STIM1).
25326555 2014 Clinical, histological and genetic characterisation of patients with tubular aggregate myopathy caused by mutations in STIM1.
25296861 2014 STIM1 triggers a gating rearrangement at the extracellular mouth of the ORAI1 channel.
25190815 2014 Stromal interaction molecule 1 (STIM1) and Orai1 mediate histamine-evoked calcium entry and nuclear factor of activated T-cells (NFAT) signaling in human umbilical vein endothelial cells.
25088676 2014 STIM1 regulates TRPC6 heteromultimerization and subcellular location.
25057023 2014 Single-molecule analysis of diffusion and trapping of STIM1 and Orai1 at endoplasmic reticulum-plasma membrane junctions.
25044882 2014 Gain-of-Function Mutation in STIM1 (P.R304W) Is Associated with Stormorken Syndrome.
25030742 2014 Key components of store-operated Ca2+ entry in non-excitable cells.
25016017 2014 Cooperative signaling via transcription factors NF-?B and AP1/c-Fos mediates endothelial cell STIM1 expression and hyperpermeability in response to endotoxin.
25015419 2014 Enhanced Orai1 and STIM1 expression as well as store operated Ca2+ entry in therapy resistant ovary carcinoma cells.
24996186 2014 Atomic force microscopy (AFM) imaging suggests that stromal interaction molecule 1 (STIM1) binds to Orai1 with sixfold symmetry.
24957221 2015 Accumulation of STIM1 is associated with the degenerative muscle fibre phenotype in ALS and other neurogenic atrophies.
24954132 2014 Remodeling of channel-forming ORAI proteins determines an oncogenic switch in prostate cancer.
24845346 2014 Members of the thrombospondin gene family bind stromal interaction molecule 1 and regulate calcium channel activity.
24842273 Suppression of stromal interaction molecule 1 inhibits SMMC7721 hepatocellular carcinoma cell proliferation by inducing cell cycle arrest.
24811382 2014 STIM1 controls neuronal Ca²? signaling, mGluR1-dependent synaptic transmission, and cerebellar motor behavior.
24806964 2014 IP3-mediated STIM1 oligomerization requires intact mitochondrial Ca2+ uptake.
24755083 2014 Orai1 and STIM1 are critical for cell migration and proliferation of clear cell renal cell carcinoma.
24681268 2014 Stromal interaction molecules as important therapeutic targets in diseases with dysregulated calcium flux.
24672054 2014 The KSR2-calcineurin complex regulates STIM1-ORAI1 dynamics and store-operated calcium entry (SOCE).
24621671 2014 STIM1 and SLC24A4 Are Critical for Enamel Maturation.
24619930 2014 A dominant STIM1 mutation causes Stormorken syndrome.
24603752 2014 Enhanced expression of Stim, Orai, and TRPC transcripts and proteins in endothelial progenitor cells isolated from patients with primary myelofibrosis.
24591628 2014 Activating mutations in STIM1 and ORAI1 cause overlapping syndromes of tubular myopathy and congenital miosis.
24583265 2014 Orai1 and STIM1 mediate SOCE and contribute to apoptotic resistance of pancreatic adenocarcinoma.
24570283 2014 Childhood onset tubular aggregate myopathy associated with de novo STIM1 mutations.
24556214 2014 Enhanced Ca²? influx from STIM1-Orai1 induces muscle pathology in mouse models of muscular dystrophy.
24492416 2014 Distinct Orai-coupling domains in STIM1 and STIM2 define the Orai-activating site.
24464579 2014 Molecular determinants mediating gating of Transient Receptor Potential Canonical (TRPC) channels by stromal interaction molecule 1 (STIM1).
24463606 2014 A polarized Ca2+, diacylglycerol and STIM1 signalling system regulates directed cell migration.
24351972 2013 STIM1/Orai1 coiled-coil interplay in the regulation of store-operated calcium entry.
24308967 2014 The role of plasma membrane STIM1 and Ca(2+)entry in platelet aggregation. STIM1 binds to novel proteins in human platelets.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24114840 2013 17?-Estradiol inhibits phosphorylation of stromal interaction molecule 1 (STIM1) protein: implication for store-operated calcium entry and chronic lung diseases.
24109210 2013 Activation of the endoplasmic reticulum calcium sensor STIM1 and store-operated calcium entry by rotavirus requires NSP4 viroporin activity.
24069340 2013 The inhibitory helix controls the intramolecular conformational switching of the C-terminus of STIM1.
24044355 2013 Oligomerization and Ca2+/calmodulin control binding of the ER Ca2+-sensors STIM1 and STIM2 to plasma membrane lipids.
23994313 2013 Transient receptor potential ankyrin-1 (TRPA1) modulates store-operated Ca(2+) entry by regulation of STIM1-Orai1 association.
23943619 2013 The extended transmembrane Orai1 N-terminal (ETON) region combines binding interface and gate for Orai1 activation by STIM1.
23871111 2013 A relay mechanism between EB1 and APC facilitate STIM1 puncta assembly at endoplasmic reticulum-plasma membrane junctions.
23816623 2013 The STIM1 CTID domain determines access of SARAF to SOAR to regulate Orai1 channel function.
23800047 2013 Involvement of STIM1 and Orai1 in EGF-mediated cell growth in retinal pigment epithelial cells.
23798062 2013 A Correction to the Perspective Titled: “STIMulating Stress Fibers in Endothelial Cells".
23714431 2013 The apoptosis of non-small cell lung cancer induced by cisplatin through modulation of STIM1.
23713409 2013 Effects of the inflammatory cytokines TNF-? and IL-13 on stromal interaction molecule-1 aggregation in human airway smooth muscle intracellular Ca(2+) regulation.
23700407 2013 The Orai-1 and STIM-1 complex controls human dendritic cell maturation.
23698468 2013 Microtubule-associated histone deacetylase 6 supports the calcium store sensor STIM1 in mediating malignant cell behaviors.
23690558 2013 Molecular basis of activation of the arachidonate-regulated Ca2+ (ARC) channel, a store-independent Orai channel, by plasma membrane STIM1.
23687376 2013 Phosphorylation of STIM1 at ERK1/2 target sites regulates interaction with the microtubule plus-end binding protein EB1.
23668188 2013 STIM1 negatively regulates Ca²? release from the sarcoplasmic reticulum in skeletal myotubes.
23625915 2013 Store-operated Ca2+ entry (SOCE) induced by protease-activated receptor-1 mediates STIM1 protein phosphorylation to inhibit SOCE in endothelial cells through AMP-activated protein kinase and p38? mitogen-activated protein kinase.
23613525 2013 The C- and N-terminal STIM1 binding sites on Orai1 are required for both trapping and gating CRAC channels.
23578185 2013 Suppression of STIM1 inhibits human glioblastoma cell proliferation and induces G0/G1 phase arrest.
23572507 2013 Intramolecular shielding maintains the ER Ca²? sensor STIM1 in an inactive conformation.
23515871 2013 STIM1 and Orai1 mediate CRAC channel activity and are essential for human glioblastoma invasion.
23512989 2013 STIM1 controls endothelial barrier function independently of Orai1 and Ca2+ entry.
23512987 2013 STIMulating stress fibers in endothelial cells.
23458835 2013 STIM1 participates in the contractile rhythmicity of HL-1 cells by moderating T-type Ca(2+) channel activity.
23447534 2013 Differential roles of the C and N termini of Orai1 protein in interacting with stromal interaction molecule 1 (STIM1) for Ca2+ release-activated Ca2+ (CRAC) channel activation.
23397206 2013 STIM1-regulated Ca2+ influx across the apical and the basolateral membrane in colonic epithelium.
23395841 2013 The polybasic lysine-rich domain of plasma membrane-resident STIM1 is essential for the modulation of store-operated divalent cation entry by extracellular calcium.
23378028 2013 The ER Ca²? sensor STIM1 regulates actomyosin contractility of migratory cells.
23348743 2013 Blockade of NOX2 and STIM1 signaling limits lipopolysaccharide-induced vascular inflammation.
23332920 2013 Constitutive activation of the calcium sensor STIM1 causes tubular-aggregate myopathy.
23320111 2013 Comprehensive analysis and identification of the human STIM1 domains for structural and functional studies.
23289723 2013 Silencing of STIM1 attenuates hypoxia-induced PASMCs proliferation via inhibition of the SOC/Ca2+/NFAT pathway.
23277085 2013 STIM1 and Orai in cardiac hypertrophy and vascular proliferative diseases.
23272049 2012 Genetic polymorphisms of stromal interaction molecule 1 associated with the erythrocyte sedimentation rate and C-reactive protein in HLA-B27 positive ankylosing spondylitis patients.
23261659 2013 High expression of STIM1 in the early stages of diffuse axonal injury.
23212906 2013 Mutations of the Ca2+-sensing stromal interaction molecule STIM1 regulate Ca2+ influx by altered oligomerization of STIM1 and by destabilization of the Ca2+ channel Orai1.
23203809 2013 Impairment of TRPC1-STIM1 channel assembly and AQP5 translocation compromise agonist-stimulated fluid secretion in mice lacking caveolin1.
23203806 2013 Role of STIM1- and Orai1-mediated Ca2+ entry in Ca2+-induced epidermal keratinocyte differentiation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23184982 2012 Orai-STIM-mediated Ca2+ release from secretory granules revealed by a targeted Ca2+ and pH probe.
23108404 2013 mTORC1 enhancement of STIM1-mediated store-operated Ca2+ entry constrains tuberous sclerosis complex-related tumor development.
23076152 2012 Stromal interaction molecule 1 (STIM1) is involved in the regulation of mitochondrial shape and bioenergetics and plays a role in oxidative stress.
23068106 2012 Different binding property of STIM1 and its novel splice variant STIM1L to Orai1, TRPC3, and TRPC6 channels.
23049826 2012 Cytoskeleton reorganization as an alternative mechanism of store-operated calcium entry control in neuroendocrine-differentiated cells.
23043102 2012 Role of molecular determinants of store-operated Ca(2+) entry (Orai1, phospholipase A2 group 6, and STIM1) in focal adhesion formation and cell migration.
23041196 2012 STIM1 juxtaposes ER to phagosomes, generating Ca²? hotspots that boost phagocytosis.
23022228 2012 Knockdown of stromal interaction molecule 1 (STIM1) suppresses store-operated calcium entry, cell proliferation and tumorigenicity in human epidermoid carcinoma A431 cells.
22992728 2012 Modification of STIM1 by O-linked N-acetylglucosamine (O-GlcNAc) attenuates store-operated calcium entry in neonatal cardiomyocytes.
22984609 2012 STIM1 regulates platelet-derived growth factor-induced migration and Ca2+ influx in human airway smooth muscle cells.
22914293 2012 STIM proteins: dynamic calcium signal transducers.
22904194 2012 STIM1 and STIM2 protein deficiency in T lymphocytes underlies development of the exocrine gland autoimmune disease, Sjogren's syndrome.
22842488 2012 Store-independent pathways for cytosolic STIM1 clustering in the regulation of store-operated Ca(2+) influx.
22748319 2012 Phosphoregulation of STIM1 leads to exclusion of the endoplasmic reticulum from the mitotic spindle.
22592407 2012 Polyamines regulate intestinal epithelial restitution through TRPC1-mediated Ca²+ signaling by differentially modulating STIM1 and STIM2.
22586105 2012 Junctate is a Ca2+-sensing structural component of Orai1 and stromal interaction molecule 1 (STIM1).
22549787 2012 Overexpression of Orai1 and STIM1 proteins alters regulation of store-operated Ca2+ entry by endogenous mediators.
22498042 2012 Di-arginine signals and the K-rich domain retain the Ca²? sensor STIM1 in the endoplasmic reticulum.
22464749 2012 SARAF inactivates the store operated calcium entry machinery to prevent excess calcium refilling.
22451904 2012 Structural and mechanistic insights into the activation of Stromal interaction molecule 1 (STIM1).
22438918 2012 Visualisation and identification of the interaction between STIM1s in resting cells.
22387225 2012 STIM1 tyrosine-phosphorylation is required for STIM1-Orai1 association in human platelets.
22384096 2012 Intracellular alkalinization induces cytosolic Ca2+ increases by inhibiting sarco/endoplasmic reticulum Ca2+-ATPase (SERCA).
22381755 2012 [Effect of sodium butyrate on apoptosis and stromal interaction molecule and Orai1 activity in human colon cancer HCT-116 cells in vitro].
22298778 2012 cAMP induces stromal interaction molecule 1 (STIM1) puncta but neither Orai1 protein clustering nor store-operated Ca2+ entry (SOCE) in islet cells.
22278058 2012 Gated regulation of CRAC channel ion selectivity by STIM1.
22260675 2012 Morphological and functional aspects of STIM1-dependent assembly and disassembly of store-operated calcium entry complexes.
22246182 2012 STIM1 is required for attenuation of PMCA-mediated Ca2+ clearance during T-cell activation.
22190180 2012 Antiviral and regulatory T cell immunity in a patient with stromal interaction molecule 1 deficiency.
22110130 2012 Transcription factor NF-?B regulates expression of pore-forming Ca2+ channel unit, Orai1, and its activator, STIM1, to control Ca2+ entry and affect cellular functions.
22084111 2011 POST, partner of stromal interaction molecule 1 (STIM1), targets STIM1 to multiple transporters.
22031597 2012 PDGF enhances store-operated Ca2+ entry by upregulating STIM1/Orai1 via activation of Akt/mTOR in human pulmonary arterial smooth muscle cells.
21941299 2011 Modulation of STIM1 and capacitative Ca2+ entry by the endoplasmic reticulum luminal oxidoreductase ERp57.
21906591 2011 Store-operated calcium entry modulates neuronal network activity in a model of chronic epilepsy.
21880734 2011 Local cytosolic Ca2+ elevations are required for stromal interaction molecule 1 (STIM1) de-oligomerization and termination of store-operated Ca2+ entry.
21876174 2011 Calcium store sensor stromal-interaction molecule 1-dependent signaling plays an important role in cervical cancer growth, migration, and angiogenesis.
21790973 2012 Orais and STIMs: physiological mechanisms and disease.
21788372 2011 STIM1L is a new actin-binding splice variant involved in fast repetitive Ca2+ release.
21724845 2011 Molecular determinants within N terminus of Orai3 protein that control channel activation and gating.
21640715 2011 The cytoskeleton plays a modulatory role in the association between STIM1 and the Ca2+ channel subunits Orai1 and TRPC1.
21540881 2011 Unlocking SOAR releases STIM.
21499266 2011 Temperature-dependent STIM1 activation induces Ca²+ influx and modulates gene expression.
21432868 2011 The calcium sensor STIM1 is regulated by androgens in prostate stromal cells.
21427704 2011 STIM1 couples to ORAI1 via an intramolecular transition into an extended conformation.
21321120 2011 STIM1 and STIM2 are located in the acidic Ca2+ stores and associates with Orai1 upon depletion of the acidic stores in human platelets.
21269460 2011 Initial characterization of the human central proteome.
21255618 2011 Lipid rafts are essential for the regulation of SOCE by plasma membrane resident STIM1 in human platelets.
21239714 2011 An essential role of STIM1, Orai1, and S100A8-A9 proteins for Ca2+ signaling and Fc?R-mediated phagosomal oxidative activity.
21220431 2011 Role of the STIM1 C-terminal domain in STIM1 clustering.
21220420 2011 Mitofusin 2 regulates STIM1 migration from the Ca2+ store to the plasma membrane in cells with depolarized mitochondria.
21217057 2011 Auto-inhibitory role of the EF-SAM domain of STIM proteins in store-operated calcium entry.
21193399 2011 Competitive modulation of Ca2+ release-activated Ca2+ channel gating by STIM1 and 2-aminoethyldiphenyl borate.
21126331 2010 Reverse mode Na+/Ca2+ exchange mediated by STIM1 contributes to Ca2+ influx in airway smooth muscle following agonist stimulation.
21081754 2010 Activation of STIM1-Orai1 involves an intramolecular switching mechanism.
20976103 2010 Regulation of STIM1 and SOCE by the ubiquitin-proteasome system (UPS).
20929812 2010 The CRAC channel activator STIM1 binds and inhibits L-type voltage-gated calcium channels.
20926378 2010 STIM1-dependent and STIM1-independent function of transient receptor potential canonical (TRPC) channels tunes their store-operated mode.
20876309 2010 Whole-exome sequencing-based discovery of STIM1 deficiency in a child with fatal classic Kaposi sarcoma.
20808796 2010 Identification of a polycystin-1 cleavage product, P100, that regulates store operated Ca entry through interactions with STIM1.
20736304 2010 Phosphorylation of STIM1 at ERK1/2 target sites modulates store-operated calcium entry.
20679432 2010 S-glutathionylation activates STIM1 and alters mitochondrial homeostasis.
20629634 2010 Evidence for an interaction between Golli and STIM1 in store-operated calcium entry.
20587595 2010 Mitochondrial Ca2+ uptake and not mitochondrial motility is required for STIM1-Orai1-dependent store-operated Ca2+ entry.
20534587 2010 Protein kinase C-induced phosphorylation of Orai1 regulates the intracellular Ca2+ level via the store-operated Ca2+ channel.
20436167 2010 Human muscle economy myoblast differentiation and excitation-contraction coupling use the same molecular partners, STIM1 and STIM2.
20418871 2010 A novel EF-hand protein, CRACR2A, is a cytosolic Ca2+ sensor that stabilizes CRAC channels in T cells.
20375143 2010 Essential role for the CRAC activation domain in store-dependent oligomerization of STIM1.
20194530 2010 Expression and association of TRPC subtypes with Orai1 and STIM1 in human parathyroid.
20073506 2010 A basic sequence in STIM1 promotes Ca2+ influx by interacting with the C-terminal acidic coiled coil of Orai1.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19906989 2009 From the Cover: STIM1-induced precortical and cortical subdomains of the endoplasmic reticulum.
19897728 2009 Activation of TRPC1 by STIM1 in ER-PM microdomains involves release of the channel from its scaffold caveolin-1.
19881501 2009 Phosphorylation of STIM1 underlies suppression of store-operated calcium entry during mitosis.
19843011 2009 Role of phosphoinositides in STIM1 dynamics and store-operated calcium entry.
19765994 2009 STIM1 is a calcium sensor specialized for digital signaling.
19754898 2009 ORAI1 and STIM1 deficiency in human and mice: roles of store-operated Ca2+ entry in the immune system and beyond.
19706554 2009 Molecular determinants of fast Ca2+-dependent inactivation and gating of the Orai channels.
19694801 2009 A single EF-hand isolated from STIM1 forms dimer in the absence and presence of Ca2+.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19632184 2009 An EB1-binding motif acts as a microtubule tip localization signal.
19631699 2009 Store-operated Ca2+ entry is sensitive to the extracellular Ca2+ concentration through plasma membrane STIM1.
19626660 2009 Involvement of STIM1 in the proteinase-activated receptor 1-mediated Ca2+ influx in vascular endothelial cells.
19622747 2009 A Ca2(+ )release-activated Ca2(+) (CRAC) modulatory domain (CMD) within STIM1 mediates fast Ca2(+)-dependent inactivation of ORAI1 channels.
19506081 2009 Molecular determinants of the coupling between STIM1 and Orai channels: differential activation of Orai1-3 channels by a STIM1 coiled-coil mutant.
19487696 2009 The short N-terminal domains of STIM1 and STIM2 control the activation kinetics of Orai1 channels.
19447651 Enhanced expression of STIM1/Orai1 and TRPC3 in platelets from patients with type 2 diabetes mellitus.
19433064 2009 STIM1 but not STIM2 is an essential regulator of Ca2+ influx-mediated NADPH oxidase activity in neutrophil-like HL-60 cells.
19433061 2009 A minimal regulatory domain in the C terminus of STIM1 binds to and activates ORAI1 CRAC channels.
19429662 2009 Dominant role of Orai1 with STIM1 on the cytosolic entry and cytotoxicity of lead ions.
19420366 2009 STIM1 mutation associated with a syndrome of immunodeficiency and autoimmunity.
19403622 2009 Properties of Orai1 mediated store-operated current depend on the expression levels of STIM1 and Orai1 proteins.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
19332491 2009 TRPC channels function independently of STIM1 and Orai1.
19327826 2009 Visualizing the store-operated channel complex assembly in real time: identification of SERCA2 as a new member.
19307462 2009 Interaction between TRPC1/TRPC4 assembly and STIM1 contributes to store-operated Ca2+ entry in mesangial cells.
19287379 2009 Store-operated cyclic AMP signalling mediated by STIM1.
19272522 2009 Stim1, an endoplasmic reticulum Ca2+ sensor, negatively regulates 3T3-L1 pre-adipocyte differentiation.
19260825 2009 Dynamic interaction of hTRPC6 with the Orai1-STIM1 complex or hTRPC3 mediates its role in capacitative or non-capacitative Ca(2+) entry pathways.
19249086 2009 STIM1 clusters and activates CRAC channels via direct binding of a cytosolic domain to Orai1.
19189966 2009 A Cytosolic Homomerization and a Modulatory Domain within STIM1 C Terminus Determine Coupling to ORAI1 Channels.
19185847 2009 Orai1 and STIM1 are critical for breast tumor cell migration and metastasis.
19182790 2009 SOAR and the polybasic STIM1 domains gate and regulate Orai channels.
19171672 2009 Capacitative Ca2+ entry via Orai1 and stromal interacting molecule 1 (STIM1) regulates adenylyl cyclase type 8.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19111578 2009 Presenilin-dependent expression of STIM proteins and dysregulation of capacitative Ca2+ entry in familial Alzheimer's disease.
19107116 2009 RNA interference targeting STIM1 suppresses vascular smooth muscle cell proliferation and neointima formation in the rat.
19088073 2009 STIM1- and Orai1-dependent store-operated calcium entry regulates human myoblast differentiation.
19052075 2009 An essential role for stromal interaction molecule 1 in neointima formation following arterial injury.
19019825 2009 Stromal interaction molecule (STIM) 1 and STIM2 calcium sensing regions exhibit distinct unfolding and oligomerization kinetics.
18995841 2008 STIM1 gates TRPC channels, but not Orai1, by electrostatic interaction.
18854159 2008 Structural and mechanistic insights into STIM1-mediated initiation of store-operated calcium entry.
18845811 2008 Stim1 and Orai1 mediate CRAC currents and store-operated calcium entry important for endothelial cell proliferation.
18843204 Role of lipid rafts in the interaction between hTRPC1, Orai1 and STIM1.
18832420 2008 STIM1-Orai1 interactions and Orai1 conformational changes revealed by live-cell FRET microscopy.
18802022 2008 Interactions, functions, and independence of plasma membrane STIM1 and TRPC1 in vascular smooth muscle cells.
18778263 2008 Dynamic imaging of calcium and STIM1 in the same cell using wide-field and TIRF microscopy.
18768920 2008 How strict is the correlation between STIM1 and Orai1 expression, puncta formation, and ICRAC activation?
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18644792 2008 Orai1 mediates the interaction between STIM1 and hTRPC1 and regulates the mode of activation of hTRPC1-forming Ca2+ channels.
18635545 2008 Location and function of STIM1 in the activation of Ca2+ entry signals.
18569867 2008 Expression profiling and electrophysiological studies suggest a major role for Orai1 in the store-operated Ca2+ influx pathway of platelets and megakaryocytes.
18542992 2008 ATP depletion induces translocation of STIM1 to puncta and formation of STIM1-ORAI1 clusters: translocation and re-translocation of STIM1 does not require ATP.
18506892 2008 Capacitative calcium entry and transient receptor potential canonical 6 expression control human hepatoma cell proliferation.
18484746 2008 Calmodulin binding to the polybasic C-termini of STIM proteins involved in store-operated calcium entry.
18448669 2008 Dynamic movement of the calcium sensor STIM1 and the calcium channel Orai1 in activated T-cells: puncta and distal caps.
18430726 2008 Lipid rafts determine clustering of STIM1 in endoplasmic reticulum-plasma membrane junctions and regulation of store-operated Ca2+ entry (SOCE).
18420269 2008 STIM1 converts TRPC1 from a receptor-operated to a store-operated channel: moving TRPC1 in and out of lipid rafts.
18403424 2008 2-Aminoethoxydiphenyl borate directly facilitates and indirectly inhibits STIM1-dependent gating of CRAC channels.
18337467 2008 Soft substrate up-regulates the interaction of STIM1 with store-operated Ca2+ channels that lead to normal epithelial cell apoptosis.
18326500 2008 Functional requirement for Orai1 in store-operated TRPC1-STIM1 channels.
18250319 2008 Orai1 and STIM1 move to the immunological synapse and are up-regulated during T cell activation.
18249114 2008 STIM1 is a MT-plus-end-tracking protein involved in remodeling of the ER.
18190941 2008 Orai1-STIM1 formed store-operated Ca2+ channels (SOCs) as the molecular components needed for Pb2+ entry in living cells.
18187424 2008 Dynamic coupling of the putative coiled-coil domain of ORAI1 with STIM1 mediates ORAI1 channel activation.
18166150 2008 Biophysical characterization of the EF-hand and SAM domain containing Ca2+ sensory region of STIM1 and STIM2.
18088087 2008 Phosphoproteome of resting human platelets.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17925382 2007 Role of the microtubule cytoskeleton in the function of the store-operated Ca2+ channel activator STIM1.
17905723 2008 STIM2 protein mediates distinct store-dependent and store-independent modes of CRAC channel activation.
17702753 2007 Mapping the interacting domains of STIM1 and Orai1 in Ca2+ release-activated Ca2+ channel activation.
17684017 2007 Visualization and manipulation of plasma membrane-endoplasmic reticulum contact sites indicates the presence of additional molecular components within the STIM1-Orai1 Complex.
17517596 2007 Live-cell imaging reveals sequential oligomerization and local plasma membrane targeting of stromal interaction molecule 1 after Ca2+ store depletion.
17486119 2007 STIM1 heteromultimerizes TRPC channels to determine their function as store-operated channels.
17360414 2007 A hexahistidine-Zn2+-dye label reveals STIM1 surface exposure.
17299780 2007 Agonist-induced calcium entry correlates with STIM1 translocation.
17298947 2007 Relocalization of STIM1 for activation of store-operated Ca(2+) entry is determined by the depletion of subplasma membrane endoplasmic reticulum Ca(2+) store.
17283081 2007 STIM1 knockdown reveals that store-operated Ca2+ channels located close to sarco/endoplasmic Ca2+ ATPases (SERCA) pumps silently refill the endoplasmic reticulum.
17224452 2007 Dynamic assembly of TRPC1-STIM1-Orai1 ternary complex is involved in store-operated calcium influx. Evidence for similarities in store-operated and calcium release-activated calcium channel components.
17218358 2007 Role of the store-operated calcium entry proteins Stim1 and Orai1 in muscarinic cholinergic receptor-stimulated calcium oscillations in human embryonic kidney cells.
17158173 2007 STIM1 regulates Ca2+ entry via arachidonate-regulated Ca2+-selective (ARC) channels without store depletion or translocation to the plasma membrane.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17045966 2006 Aggregation of STIM1 underneath the plasma membrane induces clustering of Orai1.
17020874 2006 Stored Ca2+ depletion-induced oligomerization of stromal interaction molecule 1 (STIM1) via the EF-SAM region: An initiation mechanism for capacitive Ca2+ entry.
16987424 2006 A key role for STIM1 in store operated calcium channel activation in airway smooth muscle.
16966422 2006 Ca2+ store depletion causes STIM1 to accumulate in ER regions closely associated with the plasma membrane.
16906149 2006 STIM1 carboxyl-terminus activates native SOC, I(crac) and TRPC1 channels.
16870612 2006 Interaction of STIM1 with endogenously expressed human canonical TRP1 upon depletion of intracellular Ca2+ stores.
16860747 2006 STIM2 is an inhibitor of STIM1-mediated store-operated Ca2+ Entry.
16807233 2006 Large store-operated calcium selective currents due to co-expression of Orai1 or Orai2 with the intracellular calcium sensor, Stim1.
16766533 2006 Orai1 and STIM reconstitute store-operated calcium channel function.
16733527 2006 Amplification of CRAC current by STIM1 and CRACM1 (Orai1).
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16537481 2006 STIM1 has a plasma membrane role in the activation of store-operated Ca(2+) channels.
16263699 2006 Elucidation of N-glycosylation sites on human platelet proteins: a glycoproteomic approach.
16208375 2005 STIM1 is a Ca2+ sensor that activates CRAC channels and migrates from the Ca2+ store to the plasma membrane.
16005298 2005 STIM is a Ca2+ sensor essential for Ca2+-store-depletion-triggered Ca2+ influx.
15866891 2005 STIM1, an essential and conserved component of store-operated Ca2+ channel function.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14582397 2003 [Polymorphism of genes for xenobiotic metabolism in petrochemical workers].
12754519 2003 Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11983428 2002 Stromal interaction molecule 1 (STIM1), a transmembrane protein with growth suppressor activity, contains an extracellular SAM domain modified by N-linked glycosylation.
11463338 2001 Identification and characterization of the STIM (stromal interaction molecule) gene family: coding for a novel class of transmembrane proteins.
11004585 2000 STIM1: a novel phosphoprotein located at the cell surface.
10575208 1999 Exon structure and promoter identification of STIM1 (alias GOK), a human gene causing growth arrest of the human tumor cell lines G401 and RD.
9377559 1997 GOK: a gene at 11p15 involved in rhabdomyosarcoma and rhabdoid tumor development.
8921403 1996 Molecular cloning of a novel human gene (D11S4896E) at chromosomal region 11p15.5.
8707854 1996 Identification of stromal cell products that interact with pre-B cells.
225862 1979 Further characterization of the oncornavirus inactivating factor in normal mouse serum.