Property Summary

NCBI Gene PubMed Count 54
PubMed Score 65.83
PubTator Score 59.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma 1.300 1.6e-03
atypical teratoid / rhabdoid tumor 1.200 1.0e-03
Breast cancer -2.300 1.0e-04
breast carcinoma 1.200 1.2e-02
colon cancer 2.700 3.5e-02
cystic fibrosis 1.900 5.9e-05
fibroadenoma 2.600 3.7e-03
glioblastoma 1.200 2.5e-03
intraductal papillary-mucinous adenoma (... -2.300 7.0e-05
intraductal papillary-mucinous carcinoma... -2.200 2.6e-04
intraductal papillary-mucinous neoplasm ... -2.100 3.8e-03
lung cancer -1.600 6.2e-04
malignant mesothelioma -1.200 1.0e-06
medulloblastoma, large-cell 2.300 5.1e-05
osteosarcoma 1.773 3.0e-02
ovarian cancer 1.900 1.9e-06
posterior fossa group A ependymoma 1.700 4.0e-07
psoriasis -1.300 8.0e-03
sonic hedgehog group medulloblastoma 1.200 2.3e-02

Synonym

Accession O76061 STC-2
Symbols STC-2
STCRP

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (40)

AA Sequence

MCAERLGQFMTLALVLATFDPARGTDATNPPEGPQDRSSQQKGRLSLQNTAEIQHCLVNAGDVGCGVFEC      1 - 70
FENNSCEIRGLHGICMTFLHNAGKFDAQGKSFIKDALKCKAHALRHRFGCISRKCPAIREMVSQLQRECY     71 - 140
LKHDLCAAAQENTRVIVEMIHFKDLLLHEPYVDLVNLLLTCGEEVKEAITHSVQVQCEQNWGSLCSILSF    141 - 210
CTSAIQKPPTAPPERQPQVDRTKLSRAHHGEAGHHLPEPSSRETGRGAKGERGSKSHPNAHARGRVGGLG    211 - 280
AQGPSGSSEWEDEQSEYSDIRR                                                    281 - 302
//

Text Mined References (55)

PMID Year Title