Property Summary

NCBI Gene PubMed Count 28
PubMed Score 146.57
PubTator Score 248.81

Knowledge Summary

Patent

No data available

Gene RIF (9)

PMID Text
25128293 effects of statherin on intracellular calcium level and its subsequent related molecular alterations would give us new pathogenic aspect in oral carcinogenesis
23333304 HIV-1 Vif upregulates the expression of statherin (STATH) in Vif-expression T cells
22563672 phenylalanine orientations in statherin bound to hydroxyapatite surfaces
20731414 Data show that the full characterization of the statherin peptides generated facilitates the elucidation of their novel functional roles in the oral and gastro-intestinal environment.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19799638 In conclusion, statherin induces transition to yeast of Candida albicans hyphae and may thus contribute to the oral defense against candidiasis.
19678690 insight into the molecular interactions of statherin with hydroxyapatite surfaces
15769251 results suggest that a layer rich in statherin forms at the interface of saliva and air, and that the surface rheology developed is dependent upon protein interactions mediated by calcium
12060866 inhibits calcium phosphate precipitation

AA Sequence

MKFLVFAFILALMVSMIGADSSEEKFLRRIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF              1 - 62
//

Text Mined References (34)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25128293 2014 Role of statherin in oral carcinogenesis.
22563672 2012 Direct observation of phenylalanine orientations in statherin bound to hydroxyapatite surfaces.
20731414 2010 Mass spectrometric identification of key proteolytic cleavage sites in statherin affecting mineral homeostasis and bacterial binding domains.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19799638 2009 Identification of salivary components that induce transition of hyphae to yeast in Candida albicans.
19678690 2009 A (13)C{(31)P} REDOR NMR investigation of the role of glutamic acid residues in statherin- hydroxyapatite recognition.
17389930 2007 Tyrosine sulfation of statherin.
17313100 2006 HPLC-MS characterization of cyclo-statherin Q-37, a specific cyclization product of human salivary statherin generated by transglutaminase 2.
16203048 2005 Two-hybrid analysis of human salivary mucin MUC7 interactions.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15769251 2005 A statherin and calcium enriched layer at the air interface of human parotid saliva.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12444093 2003 Identification of protein components in human acquired enamel pellicle and whole saliva using novel proteomics approaches.
12060866 2002 Comparison of inhibitory activity on calcium phosphate precipitation by acidic proline-rich proteins, statherin, and histatin-1.
10831095 2000 Pellicle precursor protein crosslinking characterization of an adduct between acidic proline-rich protein (PRP-1) and statherin generated by transglutaminase.
10748043 2000 Chimeric peptides of statherin and osteopontin that bind hydroxyapatite and mediate cell adhesion.
10728974 2000 Molecular mapping of statherin- and histatin-binding domains in human salivary mucin MG1 (MUC5B) by the yeast two-hybrid system.
9109822 1997 Human salivary mucin MG1 selectively forms heterotypic complexes with amylase, proline-rich proteins, statherin, and histatins.
9048421 Solid-phase synthesis and characterization of human salivary statherin: a tyrosine-rich phosphoprotein inhibitor of calcium phosphate precipitation.
7876428 1995 Characterization of low-molecular-weight peptides in human parotid saliva.
3502720 1987 cDNA cloning and chromosomal localization (4q11-13) of a gene for statherin, a regulator of calcium in saliva.
3476566 1987 Molecular basis of salivary proline-rich protein and peptide synthesis: cell-free translations and processing of human and macaque statherin mRNAs and partial amino acid sequence of their signal peptides.
3426601 1987 Human submandibular gland statherin and basic histidine-rich peptide are encoded by highly abundant mRNA's derived from a common ancestral sequence.
2483725 1989 Tissue distribution of RNAs for cystatins, histatins, statherin, and proline-rich salivary proteins in humans and macaques.
2373369 1990 Structure and sequence determination of the gene encoding human salivary statherin.
1747107 1991 Large-scale purification and characterization of the major phosphoproteins and mucins of human submandibular-sublingual saliva.
1741693 1991 The effects of human salivary cystatins and statherin on hydroxyapatite crystallization.
1718282 1991 Statherin: a major boundary lubricant of human saliva.
1663737 1991 Multiple forms of statherin in human salivary secretions.
1313424 1992 Salivary statherin. Dependence on sequence, charge, hydrogen bonding potency, and helical conformation for adsorption to hydroxyapatite and inhibition of mineralization.
838735 1977 Complete covalent structure of statherin, a tyrosine-rich acidic peptide which inhibits calcium phosphate precipitation from human parotid saliva.