Property Summary

NCBI Gene PubMed Count 29
PubMed Score 30.58
PubTator Score 60.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma -1.804 2.8e-05
cystic fibrosis -1.226 1.5e-05
atypical teratoid / rhabdoid tumor 1.500 2.5e-04
glioblastoma 1.500 7.2e-05
medulloblastoma, large-cell 1.900 1.1e-05
non-small cell lung cancer -1.379 3.2e-20
active Crohn's disease 1.070 8.0e-03
adult high grade glioma 1.700 4.1e-04
ovarian cancer 1.900 2.1e-06

Gene RIF (13)

PMID Text
24453002 The tumor suppressor ST7 is a key gene silenced by PRMT5.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20238225 ST7 mediates tumor suppression through the regulation of the genes involved in maintaining the cellular structure of the cell and involved in oncogenic pathways
19913121 Observational study of gene-disease association. (HuGE Navigator)
19736351 Observational study of gene-disease association. (HuGE Navigator)
19058789 Observational study of gene-disease association. (HuGE Navigator)
14669308 ST7 gene may not be the target gene of inactivation at 7q31 site in gastric carcinoma.
14534688 somatic mutations of ST7 do not commonly contribute to the molecular pathogenesis of human malignant myeloid tumors
12545169 These data suggest that LOH at 7q31-q35 is involved in the origin or progression of at least a subset of esophageal carcinomas, but that ST7 is not the target gene of this somatic event.
12231539 The ST7 gene is not a primary target of inactivation in most human cancers with loss of heterozygosity at 7q31.1-q31.2.
12213198 The RAY1/ST7 tumor-suppressor locus on chromosome 7q31 represents a complex multi-transcript system
12107844 Mutational analysis of ST7 in a wide range of cell lines and primary epithelial cancer failed to detect mutations at this locus, with the exception of 1 missense change in a breast cancer cell line.

AA Sequence

MAEAATGFLEQLKSCIVWSWTYLWTVWFFIVLFLVYILRVPLKINDNLSTVSMFLNTLTPKFYVALTGTS      1 - 70
SLISGLILIFEWWYFRKYGTSFIEQVSVSHLRPLLGGVDNNSSNNSNSSNGDSDSNRQSVSECKVWRNPL     71 - 140
NLFRGAEYNRYTWVTGREPLTYYDMNLSAQDHQTFFTCDSDHLRPADAIMQKAWRERNPQARISAAHEAL    141 - 210
EINEIRSRVEVPLIASSTIWEIKLLPKCATAYILLAEEEATTIAEAEKLFKQALKAGDGCYRRSQQLQHH    211 - 280
GSQYEAQHRRDTNVLVYIKRRLAMCARRLGRTREAVKMMRDLMKEFPLLSMFNIHENLLEALLELQAYAD    281 - 350
VQAVLAKYDDISLPKSATICYTAALLKARAVSDKFSPEAASRRGLSTAEMNAVEAIHRAVEFNPHVPKYL    351 - 420
LEMKSLILPPEHILKRGDSEAIAYAFFHLAHWKRVEGALNLLHCTWEGTFRMIPYPLEKGHLFYPYPICT    421 - 490
ETADRELLPSFHEVSVYPKKELPFFILFTAGLCSFTAMLALLTHQFPELMGVFAKAMIDIFCSAEFRDWN    491 - 560
CKSIFMRVEDELEIPPAPQSQHFQN                                                 561 - 585
//

Text Mined References (34)

PMID Year Title
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24453002 2014 Genetic validation of the protein arginine methyltransferase PRMT5 as a candidate therapeutic target in glioblastoma.
22872573 2012 Genome-wide association study of prognosis in advanced non-small cell lung cancer patients receiving platinum-based chemotherapy.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20238225 2011 Localization and characterization of ST7 in cancer.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19736351 2009 Recurrent rearrangements in synaptic and neurodevelopmental genes and shared biologic pathways in schizophrenia, autism, and mental retardation.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16683024 2006 Distinguishing protein-coding from non-coding RNAs through support vector machines.
16474848 2006 ST7-mediated suppression of tumorigenicity of prostate cancer cells is characterized by remodeling of the extracellular matrix.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14669308 2003 Somatic mutation analysis of p53 and ST7 tumor suppressor genes in gastric carcinoma by DHPLC.
14534688 Mutational analysis of the ST7 gene in human myeloid tumor cell lines.
12853948 2003 The DNA sequence of human chromosome 7.
12809483 2003 ST7 is a novel low-density lipoprotein receptor-related protein (LRP) with a cytoplasmic tail that interacts with proteins related to signal transduction pathways.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12545169 2003 An LOH and mutational investigation of the ST7 gene locus in human esophageal carcinoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12231539 2002 Absence of ST7 gene alterations in human cancer.
12213198 2002 The RAY1/ST7 tumor-suppressor locus on chromosome 7q31 represents a complex multi-transcript system.
12107844 2002 Lack of mutations within ST7 gene in tumour-derived cell lines and primary epithelial tumours.
11726923 2001 Mutation of the ST7 tumor suppressor gene on 7q31.1 is rare in breast, ovarian and colorectal cancers.
11279520 2001 Mutational and functional analyses reveal that ST7 is a highly conserved tumor-suppressor gene on human chromosome 7q31.
10889047 2000 Identification of a novel gene on chromosome 7q31 that is interrupted by a translocation breakpoint in an autistic individual.
10889044 2000 Chromosome 7q: where autism meets language disorder?
8938430 1996 Novel susceptibility locus for mouse hepatomas: evidence for a conserved tumor suppressor gene.
8105370 1993 Chromosome 7 suppresses indefinite division of nontumorigenic immortalized human fibroblast cell lines KMST-6 and SUSM-1.
7991599 1994 (C-A)n microsatellite repeat D7S522 is the most commonly deleted region in human primary breast cancer.
7987830 1994 Loss of heterozygosity in human primary prostate carcinomas: a possible tumor suppressor gene at 7q31.1.
7624150 1995 Allelic loss at 7q31.1 in human primary ovarian carcinomas suggests the existence of a tumor suppressor gene.