Property Summary

NCBI Gene PubMed Count 16
PubMed Score 6.75
PubTator Score 7.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Breast cancer -1.300 3.1e-02
ductal carcinoma in situ -1.100 5.3e-03
ependymoma 1.500 7.3e-06
group 4 medulloblastoma -1.500 3.7e-04
invasive ductal carcinoma -1.400 1.0e-02
lung adenocarcinoma -1.300 5.8e-18
medulloblastoma, large-cell -1.200 1.2e-03
non-small cell lung cancer -1.352 2.5e-15
ovarian cancer -1.300 4.0e-09
pancreatic cancer 1.100 9.9e-04
pancreatic carcinoma 1.100 9.9e-04

Protein-protein Interaction (6)

Gene RIF (5)

AA Sequence

MACILKRKSVIAVSFIAAFLFLLVVRLVNEVNFPLLLNCFGQPGTKWIPFSYTYRRPLRTHYGYINVKTQ      1 - 70
EPLQLDCDLCAIVSNSGQMVGQKVGNEIDRSSCIWRMNNAPTKGYEEDVGRMTMIRVVSHTSVPLLLKNP     71 - 140
DYFFKEANTTIYVIWGPFRNMRKDGNGIVYNMLKKTVGIYPNAQIYVTTEKRMSYCDGVFKKETGKDRVQ    141 - 210
SGSYLSTGWFTFLLAMDACYGIHVYGMINDTYCKTEGYRKVPYHYYEQGRDECDEYFLHEHAPYGGHRFI    211 - 280
TEKKVFAKWAKKHRIIFTHPNWTLS                                                 281 - 305
//

Text Mined References (17)

PMID Year Title