Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.67
PubTator Score 2.31

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
psoriasis 6685 6.1e-18
spina bifida 1064 3.6e-02


  Differential Expression (2)

Disease log2 FC p
spina bifida 1.046 3.6e-02
psoriasis -1.200 6.1e-18

AA Sequence

AVKRLAEMAWTTSMPAPTTTTPEEEERPLRGDV                                        1541 - 1573

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
19535143 2009 Molecular cloning and analysis of SSc5D, a new member of the scavenger receptor cysteine-rich superfamily.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.