Property Summary

NCBI Gene PubMed Count 5
PubMed Score 7.67
PubTator Score 2.31

Knowledge Summary


No data available


  Disease (3)

Disease Target Count P-value
psoriasis 6694 6.1e-18
spina bifida 1074 3.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Syndromic X-linked intellectual disability Snyder type 21 4.098 2.0


  Differential Expression (2)

Disease log2 FC p
psoriasis -1.200 6.1e-18
spina bifida 1.046 3.6e-02

AA Sequence

AVKRLAEMAWTTSMPAPTTTTPEEEERPLRGDV                                        1541 - 1573

Text Mined References (7)

PMID Year Title