Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.13
PubTator Score 0.67

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
glioblastoma -1.200 2.5e-04
medulloblastoma -1.100 2.1e-03
medulloblastoma, large-cell -1.200 7.2e-04
osteosarcoma 1.221 3.1e-04
ovarian cancer 1.200 1.2e-04
pancreatic ductal adenocarcinoma liver m... 1.013 4.9e-03
tuberculosis 1.700 1.0e-08

Protein-protein Interaction (10)

Gene RIF (2)

AA Sequence

MYAKGGKGSAVPSDSQAREKLALYVYEYLLHIGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDL      1 - 70
YCAAPDRREACEHSGEAKAFQDYSAAAAPSPVMGSMAPGDTMAAGSMAAGFFQGPPGSQPSPHNPNAPMM     71 - 140
GPHGQPFMSPRFPGGPRPTLRMPSQPPAGLPGSQPLLPGAMEPSPRAQGHPSMGGPMQRVTPPRGMASVG    141 - 210
PQSYGGGMRPPPNSLAGPGLPAMNMGPGVRGPWASPSGNSIPYSSSSPGSYTGPPGGGGPPGTPIMPSPG    211 - 280
DSTNSSENMYTIMNPIGQGAGRANFPLGPGPEGPMAAMSAMEPHHVNGSLGSGDMDGLPKSSPGAVAGLS    281 - 350
NAPGTPRDDGEMAAAGTFLHPFPSESYSPGMTMSV                                       351 - 385
//

Text Mined References (19)

PMID Year Title