Property Summary

NCBI Gene PubMed Count 98
PubMed Score 278.93
PubTator Score 1377.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -1.600 8.5e-05
osteosarcoma -1.492 3.1e-05
juvenile dermatomyositis 1.168 2.1e-12
acute quadriplegic myopathy 1.172 2.6e-06
lung cancer 2.000 9.8e-05
lung adenocarcinoma 1.467 3.3e-07
progressive supranuclear palsy -1.300 4.6e-03
gastric carcinoma 1.200 4.2e-02
ovarian cancer 1.800 1.3e-03

Gene RIF (69)

PMID Text
26339049 At the 3' UTR, HUR facilitates circularization of the viral genome through interaction with another host factor, La, which is critical for replication.
25845745 Endoplasmic reticulum stress causes autophagy and apoptosis leading to cellular redistribution of the SS-A and SS-B autoantigens in salivary gland epithelial cells of Sjogren's syndrome patients.
25582858 expression of nuclear hLa Ag induces thymic clonal deletion and tTreg selection, and lymphocytic infiltration of the lung is a consequence of La-specific CD4(+) T cell autoimmunity
25520193 Authors provide a model whereby a novel interplay between RNA-binding, RNA chaperoning and AKT phosphorylation of La protein regulates CCND1 IRES-mediated translation.
24529195 Primary Sjogren's patients with WSP form a benign subgroup, with a lower prevalence of anti-SSB and extraglandular manifestations.
24478427 A beta turn in the human La protein is responsible for the interaction with the hepatitis C virus RNA.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of Sjogren syndrome antigen B (SSB, autoantigen La) expression by HIV-1 Vpr in Vpr transduced macrophages
23554036 Total IgG levels correlate positively with autoantibodies La, Ro60 and Ro52 but not with RING or B-box domain antibodies of Ro52.
23552417 Our study demonstrates that La plays a critical role in regulating HCV replication by interacting with the GCAC motif.
23129761 Sjogren syndrome antigen B (SSB)/La promotes global microRNA expression by binding microRNA precursors through stem-loop recognition
22944692 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of Sjogren syndrome antigen B (SSB, autoantigen La) expression by HIV-1 Vpr in Vpr transduced macrophages
22634302 Iron promotes the translation initiation of hepatitis C virus by stimulating the expression of eIF3A and La proteins.
22355520 The competition between the host factor (La) and the viral protein (NS3) for binding to HCV IRES might regulate the molecular switch from translation to replication of HCV.
22207702 oxidants cause nuclear export of La/SSB protein and subsequent association of La/SSB with Nrf2 untranslated regions and ribosomes
22203678 the structural elements required for La-mediated RNA chaperone activity
22190034 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of Sjogren syndrome antigen B (SSB, autoantigen La) expression by HIV-1 Vpr in Vpr transduced macrophages
22174317 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of Sjogren syndrome antigen B (SSB, autoantigen La) expression by HIV-1 Vpr in Vpr transduced macrophages
22055194 Autoantigen La promotes efficient RNAi, antiviral response, and transposon silencing by facilitating multiple-turnover RNA-induced silencing complex catalysis.
22016766 function of the RNA-binding protein La in promoting tumor progression of head and neck squamous cell carcinoma
22009680 La binds to domain IV of the hepatitis C virus RNA using an RNA recognition that is quite distinct from its mode of binding to RNAs with a 3' UUU(OH) trailer.
21785463 data indicate that the JAK2(V617F) mutation affects p53 response to DNA damage through the upregulation of La antigen and accumulation of MDM2
21343359 Overexpression of mouse or human La enhanced M-MuLV particle release in the absence of glycosylated gag.
21294637 La protein binds to and mediates interaction of the 5' and 3' noncoding ends of the Japanese encephalitis virus genome.
21060685 conclude that RNPs containing hY RNAs and Ro60, La or nucleolin are not required for the function of hY RNAs in chromosomal DNA replication in a human cell-free system, which can be mediated by Y RNAs outside of these RNPs
20856207 show elevated La protein expression in cervical cancer tissue and its correlation with aberrant CCND1 protein levels in cervical tumor tissue lysates
20497049 study found expression of La protein is induced by HCV infection, and this induced La protein-activated telomerase activity in a hepatoma cell line; HCV infection might be strongly related to telomerase activity in the liver through La protein induction
19567621 Nine of the 45 consecutive CHB cases (20%) were anti-Ro/La-negative with no known cause; they were less stable and complete than the anti-Ro/La positive cases
19287396 The authors show that La preferentially binds pre-tRNAs over processed tRNAs or 3' trailer products through coupled use of two sites: one on the La motif and another on the RRM1 beta-surface that binds elsewhere on tRNA.
19264640 Using electrophoretic mobility-shift and UV cross-linking assays, as well as a yeast three-hybrid system, it was shown here that La protein binds to the 3' stem-loop (SL) structure of Japanese encephalitis virus genome.
19074175 the frequency of La/SSB antibodies was higher in sporadic systemic lupus erythematosus (P = 0.048) than in those with familial SLE, although this was not significant after application of Bonferroni's correction for the number of comparisons
18550659 La supports the growth of nonsegmented negative-strand RNA viruses by both IFN suppression and a potentially novel IFN-independent mechanism
18547518 Identification of a conserved set of interactions with the last two nucleotides at the 3' end of the RNA ligand that are key to binding by the La protein.
18282467 The La-mediated suppression of HAV translation and stimulation of poliovirus translation implies unexpected mechanistic differences between viral internal ribosomal entry site elements.
18187620 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of Sjogren syndrome antigen B (SSB, autoantigen La) expression by HIV-1 Vpr in Vpr transduced macrophages
18187620 Knockdown of Sjogren syndrome antigen B (SSB) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17985193 the autoantibodies to SSB/La may modulate neutrophils function in systemic lupus erythematosis
17945310 Results suggest that La protein is cleaved by granzyme B and N-terminal La fragment (27 kD) translocated to the cytoplasm, thus leading to a novel autoantibody production during granzyme B-mediated cytotoxicity.
17875783 Overexpression of La autoantigen is associated with neoplasms
17552056 Increased Ro/SSA 60 and La/SSB mRNA expression in minor salivary glands in primary Sjogren's syndrome (pSS) suggest that these these 2 autoantigens, but not Ro/SSA 52, are involved in the tissue-specific autoimmune response in pSS.
17346312 La autoantigen can interact with both the 3' and 5'UTRs of coxsackievirus B3 independently of the poly(A) tail and may share the same binding site on the La protein.
17308035 suggest that conserved elements mediate nuclear retention, nuclear export, and RNA-binding activities of the multifunctional La protein
17064465 There is a correlation between La protein and HBV mRNA and the expression of HBV protein.
16906225 Nuclear injury and the translocation of SSA/Ro and SSB/La antigens to the fetal cardiocyte plasma membrane were common downstream events of Fas and TNF receptor ligation.
16849479 In mice transgenic for the mutant form of La autoantigen, mutant La mRNAs are not only repressed and translated to mutant La protein but, unexpectedly, expression of mutant La favors the development of systemic autoimmunity.
16682524 La protein undergoes nucleocytoplasmic shuttling whereas EBER1 and EBER2 noncoding RNA's are confined to the nucleus.
16467037 Changes in salivary production rate are associated with aging and SSB antibodies.
16387655 Results report the crystal structure of the N-terminal domain of human La, consisting of La and RRM1 motifs, bound to RNA.
16344466 Here, we show by chromatin immunoprecipitation (ChIP) that La is associated with pol III-transcribed genes in vivo
16320341 Anti-La antibodies bound to immunodominant epitopes of La within the NH(2)-terminus and the RNA recognition motif (RRM) region of apoptotic human cells
16107699 nuclear retention of peptidylglycine alpha-amidating monooxygenase (PAM) mRNA is lost upon expressing the La proteins that lack a conserved nuclear retention element, suggesting a direct association between PAM mRNA and La protein in vivo
15928345 In vitro RNA chaperone activity pf SSB was studied.
15823607 essential for efficient hepatitis C virus replication
15685555 This protein is s host factors responsible for the regulation of the hepatitis C virus internal ribosome entry site.
15572691 Nonphosphorylated SSB interacts with nucleolin at nucleolar sites involved in rRNA biogenesis.
15485924 CK2 is responsible for La S(366) phosphorylation in vivo
15371415 RRM1 and La motifs bind pre-tRNA
15302879 Composition of La/hepatitis B virus ribonucleoprotein particles as well as interacting cellular factors, are critical determinants in the regulation of the stability of the HBV RNA.
15213463 NMR assignment and secondary structure of the La motif
15084396 La protein binds to the 5' end and with the 3' UTR of Dengue virus RNA; interacts with the dengue virus nonstructural proteins NS5 and NS3
15004549 La motif adopts an alpha/beta fold that comprises a winged-helix motif elaborated by the insertion of three helices
14636586 Results suggest that La ribonucleoproteins (RNP) exist in distinct states that differ in subcellular localization, serine 366 phosphorylation, and associated RNAs.
12584332 Dengue 4 virus minus strand 3'UTR RNA binds with La protein in human monocytes
12540850 in addition to full-length La protein, both N- and C-terminal halves were able to interact with hepatitis C virus internal ribosome entry site in vivo.
12457960 binds differentially to multiple sites within the 5' untranslated region of Coxsackievirus B3 RNA
12384597 La autoantigen is required for the internal ribosome entry site-mediated translation of Coxsackievirus B3 RNA
12121976 molecular characterization of the human La protein.hepatitis B virus RNA.B interaction in vitro
12049746 nuclear trafficking by La affects the normal order of pre-tRNA processing
11580243 inhibits tRNA 3' processing
7933082 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of Sjogren syndrome antigen B (SSB, autoantigen La) expression by HIV-1 Vpr in Vpr transduced macrophages

AA Sequence

MAENGDNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVE      1 - 70
ALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNI     71 - 140
QMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYFAKKNEERKQNKVEAKLRAKQE    141 - 210
QEAKQKLEEDAEMKSLEEKIGCLLKFSGDLDDQTCREDLHILFSNHGEIKWIDFVRGAKEGIILFKEKAK    211 - 280
EALGKAKDANNGNLQLRNKEVTWEVLEGEVEKEALKKIIEDQQESLNKWKSKGRRFKGKGKGNKAAQPGS    281 - 350
GKGKVQFQGKKTKFASDDEHDEHDENGATGPVKRAREETDKEEPASKQQKTENGAGDQ                351 - 408
//

Text Mined References (112)

PMID Year Title
26339049 2015 HuR Displaces Polypyrimidine Tract Binding Protein To Facilitate La Binding to the 3' Untranslated Region and Enhances Hepatitis C Virus Replication.
25845745 2015 Endoplasmic reticulum stress causes autophagy and apoptosis leading to cellular redistribution of the autoantigens Ro/Sjögren's syndrome-related antigen A (SSA) and La/SSB in salivary gland epithelial cells.
25616068 2015 A combined proteomics/genomics approach links hepatitis C virus infection with nonsense-mediated mRNA decay.
25582858 2015 Defective selection of thymic regulatory T cells accompanies autoimmunity and pulmonary infiltrates in Tcra-deficient mice double transgenic for human La/Sjögren's syndrome-B and human La-specific TCR.
25520193 2015 Novel RNA chaperone domain of RNA-binding protein La is regulated by AKT phosphorylation.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24529195 Lower prevalence of extra-glandular manifestations and anti-SSB antibodies in patients with primary Sjögren's syndrome and widespread pain: evidence for a relatively benign subset.
24478427 2014 Specific sequence of a Beta turn in human la protein may contribute to species specificity of hepatitis C virus.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23554036 2013 Autoantibodies to the functionally active RING-domain of Ro52/SSA are associated with disease activity in patients with lupus.
23552417 2013 Human La protein interaction with GCAC near the initiator AUG enhances hepatitis C Virus RNA replication by promoting linkage between 5' and 3' untranslated regions.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23129761 2013 Sjogren syndrome antigen B (SSB)/La promotes global microRNA expression by binding microRNA precursors through stem-loop recognition.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22634302 2012 Regulation of hepatitis C virus translation initiation by iron: role of eIF3 and La protein.
22355520 2011 Interplay between NS3 protease and human La protein regulates translation-replication switch of Hepatitis C virus.
22207702 2012 La autoantigen mediates oxidant induced de novo Nrf2 protein translation.
22203678 2012 RNA chaperone activity of human La protein is mediated by variant RNA recognition motif.
22055194 2011 Autoantigen La promotes efficient RNAi, antiviral response, and transposon silencing by facilitating multiple-turnover RISC catalysis.
22016766 2011 Implication of RNA-binding protein La in proliferation, migration and invasion of lymph node-metastasized hypopharyngeal SCC cells.
22009680 2012 Analysis of the interaction with the hepatitis C virus mRNA reveals an alternative mode of RNA recognition by the human La protein.
21785463 2012 JAK2(V617F) negatively regulates p53 stabilization by enhancing MDM2 via La expression in myeloproliferative neoplasms.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21343359 2011 The cellular protein La functions in enhancement of virus release through lipid rafts facilitated by murine leukemia virus glycosylated Gag.
21294637 2011 La protein can simultaneously bind to both 3'- and 5'-noncoding regions of Japanese encephalitis virus genome.
21269460 2011 Initial characterization of the human central proteome.
21060685 2010 Ribonucleoprotein particles containing non-coding Y RNAs, Ro60, La and nucleolin are not required for Y RNA function in DNA replication.
20856207 2011 The RNA-binding protein La contributes to cell proliferation and CCND1 expression.
20497049 2010 La protein required for internal ribosome entry site-directed translation is a potential therapeutic target for hepatitis C virus replication.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19567621 2009 Congenital heart block not associated with anti-Ro/La antibodies: comparison with anti-Ro/La-positive cases.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19287396 2009 Precursor-product discrimination by La protein during tRNA metabolism.
19264640 2009 La protein binds the predicted loop structures in the 3' non-coding region of Japanese encephalitis virus genome: role in virus replication.
19135898 2009 Purification of proteins associated with specific genomic Loci.
19074175 2009 Comparison between familial and sporadic systemic lupus erythematosus in Kuwaiti patients.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18550659 2008 Cellular La protein shields nonsegmented negative-strand RNA viral leader RNA from RIG-I and enhances virus growth by diverse mechanisms.
18547518 2008 Structural analysis reveals conformational plasticity in the recognition of RNA 3' ends by the human La protein.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18282467 2008 La autoantigen suppresses IRES-dependent translation of the hepatitis A virus.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17985193 2008 Presence of antibodies to SSB/La is associated with decreased phagocytic efficiency of neutrophils in patients with systemic lupus erythematosus.
17945310 2007 La autoantigen translocates to cytoplasm after cleavage during granzyme B-mediated cytotoxicity.
17875783 2007 The La autoantigen is a malignancy-associated cell death target that is induced by DNA-damaging drugs.
17719568 2007 Subtractive hybridisation screen identifies genes regulated by glucose deprivation in human neuroblastoma cells.
17552056 2007 Differential expression of Ro/SSA 60 kDa and La/SSB, but not Ro/SSA 52 kDa, mRNA and protein in minor salivary glands from patients with primary Sjögren's syndrome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17346312 2007 Specific interaction of HeLa cell proteins with coxsackievirus B3 3'UTR: La autoantigen binds the 3' and 5'UTR independently of the poly(A) tail.
17308035 2007 Conservation of a masked nuclear export activity of La proteins and its effects on tRNA maturation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17064465 2006 [A study on the relativity between La protein and the stability of HBV mRNA and the expression of HBV protein].
16906225 2006 Impaired clearance of apoptotic cardiocytes is linked to anti-SSA/Ro and -SSB/La antibodies in the pathogenesis of congenital heart block.
16849479 2006 Autoimmunity as a result of escape from RNA surveillance.
16682524 2006 Epstein-Barr virus noncoding RNAs are confined to the nucleus, whereas their partner, the human La protein, undergoes nucleocytoplasmic shuttling.
16467037 Salivary production rates fall with age in subjects having anti-centromere, anti-Ro, and/or anti-La antibodies.
16387655 2006 Structural basis for recognition and sequestration of UUU(OH) 3' temini of nascent RNA polymerase III transcripts by La, a rheumatic disease autoantigen.
16344466 2005 Human La is found at RNA polymerase III-transcribed genes in vivo.
16320341 2005 Exposure and binding of selected immunodominant La/SSB epitopes on human apoptotic cells.
16107699 2005 Mammalian peptidylglycine alpha-amidating monooxygenase mRNA expression can be modulated by the La autoantigen.
15928345 2005 RNA chaperone activity of protein components of human Ro RNPs.
15823607 2005 Role of La autoantigen and polypyrimidine tract-binding protein in HCV replication.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15685555 2005 La protein is a potent regulator of replication of hepatitis C virus in patients with chronic hepatitis C through internal ribosomal entry site-directed translation.
15572691 2004 Nonphosphorylated human La antigen interacts with nucleolin at nucleolar sites involved in rRNA biogenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485924 2004 CK2 is responsible for phosphorylation of human La protein serine-366 and can modulate rpL37 5'-terminal oligopyrimidine mRNA metabolism.
15371415 2004 The La motif and the RNA recognition motifs of human La autoantigen contribute individually to RNA recognition and subcellular localization.
15302879 2004 Functional characterization of the interaction between human La and hepatitis B virus RNA.
15213463 2004 Resonance assignment and secondary structure of the La motif.
15084396 2004 La protein binds to NS5 and NS3 and to the 5' and 3' ends of Dengue 4 virus RNA.
15004549 2004 Structural analysis of cooperative RNA binding by the La motif and central RRM domain of human La protein.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14636586 2003 Differential phosphorylation and subcellular localization of La RNPs associated with precursor tRNAs and translation-related mRNAs.
14617813 2004 Rabip4' is an effector of rab5 and rab4 and regulates transport through early endosomes.
12842046 2003 Structure of the C-terminal domain of human La protein reveals a novel RNA recognition motif coupled to a helical nuclear retention element.
12584332 2003 Cellular proteins from human monocytes bind to dengue 4 virus minus-strand 3' untranslated region RNA.
12540850 2003 Hepatitis C virus internal ribosome entry site-mediated translation is stimulated by specific interaction of independent regions of human La autoantigen.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12458796 2002 The human La (SS-B) autoantigen interacts with DDX15/hPrp43, a putative DEAH-box RNA helicase.
12457960 2002 Specific interactions of HeLa cell proteins with Coxsackievirus B3 RNA: La autoantigen binds differentially to multiple sites within the 5' untranslated region.
12384597 2002 La autoantigen is required for the internal ribosome entry site-mediated translation of Coxsackievirus B3 RNA.
12121976 2002 Molecular characterization of the human La protein.hepatitis B virus RNA.B interaction in vitro.
12107413 2002 Expressed sequence tag analysis of adult human lens for the NEIBank Project: over 2000 non-redundant transcripts, novel genes and splice variants.
12102760 2002 Intracellular trafficking and surface expression of SS-A (Ro), SS-B (La), poly(ADP-ribose) polymerase and alpha-fodrin autoantigens during apoptosis in human salivary gland cells induced by tumour necrosis factor-alpha.
12096904 2002 Nucleolin associates with a subset of the human Ro ribonucleoprotein complexes.
12049746 2002 Aberrant nuclear trafficking of La protein leads to disordered processing of associated precursor tRNAs.
11580243 2001 The inhibitory effect of the autoantigen La on in vitro 3' processing of mammalian precursor tRNAs.
10983981 2000 Control of transfer RNA maturation by phosphorylation of the human La antigen on serine 366.
10715123 2000 Detailed analysis of the phosphorylation of the human La (SS-B) autoantigen. (De)phosphorylation does not affect its subcellular distribution.
9545582 1998 Analysis of expression of the gene encoding for the nuclear autoantigen La/SS-B using reporter gene constructs.
9415639 1997 T cell reactivity to Sjögren's syndrome related antigen La(SSB).
9173875 1997 The nuclear autoantigen La/SS-associated antigen B: one gene, three functional mRNAs.
9154801 1997 Human La protein: a stabilizer of histone mRNA.
9115276 1997 Transfection analysis of expression of mRNA isoforms encoding the nuclear autoantigen La/SS-B.
9054510 1997 Phosphorylation of the human La antigen on serine 366 can regulate recycling of RNA polymerase III transcription complexes.
7964483 1994 One gene, two transcripts: isolation of an alternative transcript encoding for the autoantigen La/SS-B from a cDNA library of a patient with primary Sjögrens' syndrome.
7933082 1994 La autoantigen alleviates translational repression by the 5' leader sequence of the human immunodeficiency virus type 1 mRNA.
7821789 1994 Construction of a human full-length cDNA bank.
3856888 1985 Isolation and analysis of cDNA clones expressing human lupus La antigen.
3192525 1988 Genomic structure and amino acid sequence domains of the human La autoantigen.
2470590 1989 Function of the mammalian La protein: evidence for its action in transcription termination by RNA polymerase III.
2468131 1989 Ribonucleoprotein SS-B/La belongs to a protein family with consensus sequences for RNA-binding.
2464497 1988 At least three distinct B cell epitopes reside in the C-terminal half of La protein, as determined by a recombinant DNA approach.
2452201 1988 Characteristics and epitope mapping of a cloned human autoantigen La.
1833722 1991 Analysis of protein--RNA interactions within Ro ribonucleoprotein complexes.
1692037 1990 Fine epitope mapping of the human SS-B/La protein. Identification of a distinct autoepitope homologous to a viral gag polyprotein.