Property Summary

NCBI Gene PubMed Count 31
PubMed Score 16.79
PubTator Score 52.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 2.7e-16
Disease Target Count Z-score Confidence
Nonspecific interstitial pneumonia 5 3.059 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.200 2.7e-16

Gene RIF (21)

PMID Text
26290602 Study shows that Srx plays a critical oncogenic role to promote cell invasion and metastasis, which is at least partially due to its stimulation of the MAPK pathway through EGFR deacetylation.
26170166 This review will summarize the molecular basis of differences in the affinity of Srx for individual Prx and the role of individual component of the Srx-Prx system in tumor progression and metastasis.
22964583 NRF2 and SRXN1 genetic polymorphisms are associated with breast cancer risk and survival
22934964 SRX forms a complex with S100A4 (and has stronger affinity for S-glutathionylated S100A4), regulates its activity, and mediates redox regulation of the interaction of S100A4 with nonmuscle myosin heavy chain II-A.
22879602 Gemfibrozil, a lipid-lowering drug, increases myelin genes in human oligodendrocytes via peroxisome proliferator-activated receptor-beta.
22086924 Srx functions as a novel component to maintain the balance between H2O2 production and elimination
21943684 Smokers and ex-smokers had significantly more sulfiredoxin expression in their tumors and in patients receiving cytostatic drugs or radiation therapy, sulfiredoxin expression predicted a poor prognosis.
21742584 Real-time PCR validated that up-regulation of sulphiredoxin 1 homolog (SRXN1), hemeoxygenase 1 (HMOX1), and breast carcinoma amplified sequence 3 (BCAS3) were consistently modulated.
21487000 Srx-Prx IV axis is critical for lung cancer maintenance and metastasis, suggesting that targeting the Srx-Prx IV axis may provide unique effective strategies for cancer prevention and treatment.
20718723 sulfiredoxin 1 is associatd with the pathogenesis of human pulmonary fibrosis.
19812042 Studies present the 2.1 A crystal structure of human Srx in complex with PrxI, ATP, and Mg(2+).
19561357 Deglutathionylation of 2-Cys Prx is specifically catalyzed by Srx.
19057013 The current study identifies Sulfiredoxin as a unique target of activator protein-1 (AP-1) activation and TAM67 inhibition.
19027064 decreased expression in lungs from patients with chronic obstructive pulmonary disorder
18593714 analysis of a protein thiosulfinate intermediate in the reduction of cysteine sulfinic acid in peroxiredoxin by human sulfiredoxin
18579529 Reduction of cysteine sulfinic acid in peroxiredoxin by sulfiredoxin proceeds directly through a sulfinic phosphoryl ester intermediate
18172504 2.6 A crystal structure of the human Srx-PrxI complex [Srx]
17176052 Aspartate-187 of peroxiredoxin (Prx) I is the catalytic residue responsible for ATP hydrolysis in the cysteinesulfinic acid reduction of Prx by human sulfiredoxin.
16818657 Actin and protein tyrosine phosphatase 1B were identified in vitro as targets of sulfiredoxin 1 (Srx1)-dependent deglutathionylation.
16565085 analysis of the reduction of cysteine sulfinic acid of peroxiredoxin to cysteine by mammalian sulfiredoxin
15952770 The reduction of the cysteine sulfinic acid moiety within the active site of the peroxiredoxin by sulfiredoxin involves novel sulfur chemistry and the use of ATP and Mg(2+).

AA Sequence

MGLRAGGTLGRAGAGRGAPEGPGPSGGAQGGSIHSGRIAAVHNVPLSVLIRPLPSVLDPAKVQSLVDTIR      1 - 70
EDPDSVPPIDVLWIKGAQGGDYFYSFGGCHRYAAYQQLQRETIPAKLVQSTLSDLRVYLGASTPDLQ        71 - 137
//

Text Mined References (37)

PMID Year Title
26290602 2015 Sulfiredoxin Promotes Colorectal Cancer Cell Invasion and Metastasis through a Novel Mechanism of Enhancing EGFR Signaling.
26170166 2015 The sulfiredoxin-peroxiredoxin (Srx-Prx) axis in cell signal transduction and cancer development.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22964583 2012 Genetic polymorphisms and protein expression of NRF2 and Sulfiredoxin predict survival outcomes in breast cancer.
22934964 2012 Sulfiredoxin redox-sensitive interaction with S100A4 and non-muscle myosin IIA regulates cancer cell motility.
22879602 2012 Gemfibrozil, a lipid-lowering drug, increases myelin genes in human oligodendrocytes via peroxisome proliferator-activated receptor-?.
22086924 2012 Sulfiredoxin protein is critical for redox balance and survival of cells exposed to low steady-state levels of H2O2.
21943684 2012 Nuclear factor erythroid-derived 2-like 2 (Nrf2) and DJ1 are prognostic factors in lung cancer.
21742584 2011 Maesopsin 4-O-beta-D-glucoside, a natural compound isolated from the leaves of Artocarpus tonkinensis, inhibits proliferation and up-regulates HMOX1, SRXN1 and BCAS3 in acute myeloid leukemia.
21487000 2011 Sulfiredoxin-Peroxiredoxin IV axis promotes human lung cancer progression through modulation of specific phosphokinase signaling.
21269460 2011 Initial characterization of the human central proteome.
20718723 2010 Cell-specific elevation of NRF2 and sulfiredoxin-1 as markers of oxidative stress in the lungs of idiopathic pulmonary fibrosis and non-specific interstitial pneumonia.
19812042 2009 Protein engineering of the quaternary sulfiredoxin.peroxiredoxin enzyme.substrate complex reveals the molecular basis for cysteine sulfinic acid phosphorylation.
19561357 2009 Deglutathionylation of 2-Cys peroxiredoxin is specifically catalyzed by sulfiredoxin.
19057013 2008 Sulfiredoxin is an AP-1 target gene that is required for transformation and shows elevated expression in human skin malignancies.
19027064 2009 Nrf2-dependent sulfiredoxin-1 expression protects against cigarette smoke-induced oxidative stress in lungs.
18593714 2008 Identification of intact protein thiosulfinate intermediate in the reduction of cysteine sulfinic acid in peroxiredoxin by human sulfiredoxin.
18579529 2008 Reduction of cysteine sulfinic acid in peroxiredoxin by sulfiredoxin proceeds directly through a sulfinic phosphoryl ester intermediate.
18172504 2008 Structure of the sulphiredoxin-peroxiredoxin complex reveals an essential repair embrace.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17176052 2006 Mutagenesis and modeling of the peroxiredoxin (Prx) complex with the NMR structure of ATP-bound human sulfiredoxin implicate aspartate 187 of Prx I as the catalytic residue in ATP hydrolysis.
16818657 2006 A novel role for human sulfiredoxin in the reversal of glutathionylation.
16565085 2006 Molecular mechanism of the reduction of cysteine sulfinic acid of peroxiredoxin to cysteine by mammalian sulfiredoxin.
16381901 2006 The LIFEdb database in 2006.
15952770 2005 Structural basis for the retroreduction of inactivated peroxiredoxins by human sulfiredoxin.
15590625 2005 Reduction of cysteine sulfinic acid by sulfiredoxin is specific to 2-cys peroxiredoxins.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15448164 2004 Characterization of mammalian sulfiredoxin and its reactivation of hyperoxidized peroxiredoxin through reduction of cysteine sulfinic acid in the active site to cysteine.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11181995 2001 The sequence of the human genome.
11076863 2000 DNA cloning using in vitro site-specific recombination.