Property Summary

NCBI Gene PubMed Count 31
PubMed Score 11.59
PubTator Score 14.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8297 6.6e-09
osteosarcoma 7766 8.1e-07
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.7
Disease Target Count Z-score Confidence
T lymphocyte deficiency 7 3.068 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.718 8.1e-07
ovarian cancer -1.400 6.6e-09

Gene RIF (6)

AA Sequence

MPRVYIGRLSYQARERDVERFFKGYGKILEVDLKNGYGFVEFDDLRDADDAVYELNGKDLCGERVIVEHA      1 - 70
RGPRRDGSYGSGRSGYGYRRSGRDKYGPPTRTEYRLIVENLSSRCSWQDLKDYMRQAGEVTYADAHKGRK     71 - 140
NEGVIEFVSYSDMKRALEKLDGTEVNGRKIRLVEDKPGSRRRRSYSRSRSHSRSRSRSRHSRKSRSRSGS    141 - 210
SKSSHSKSRSRSRSGSRSRSKSRSRSQSRSRSKKEKSRSPSKEKSRSRSHSAGKSRSKSKDQAEEKIQNN    211 - 280
DNVGKPKSRSPSRHKSKSKSRSRSQERRVEEEKRGSVSRGRSQEKSLRQSRSRSRSKGGSRSRSRSRSKS    281 - 350
KDKRKGRKRSREESRSRSRSRSKSERSRKRGSKRDSKAGSSKKKKKEDTDRSQSRSPSRSVSKEREHAKS    351 - 420
ESSQREGRGESENAGTNQETRSRSRSNSKSKPNLPSESRSRSKSASKTRSRSKSRSRSASRSPSRSRSRS    421 - 490
HSRS                                                                      491 - 494
//

Text Mined References (36)

PMID Year Title