Property Summary

NCBI Gene PubMed Count 23
PubMed Score 14.50
PubTator Score 18.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8491 3.0e-05
Multiple myeloma 1327 1.5e-03
primary pancreatic ductal adenocarcinoma 1271 5.9e-03
Disease Target Count Z-score Confidence
Bone cancer 10 0.0 2.0
Disease Target Count Z-score Confidence
Spinocerebellar ataxia type 2 19 4.401 2.2

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.442 1.5e-03
primary pancreatic ductal adenocarcinoma 1.128 5.9e-03
ovarian cancer -1.400 3.0e-05

Gene RIF (5)

PMID Text
25697503 Dats show that Alu RNA promotes functional binding of Signal Recognition Particle proteins SRP9/14 to 40S ribosomal subunits.
25010285 Interaction of HIV-1 Gag with signal recognition particle 14kDa (SRP14, homologous Alu RNA binding protein) is identified in a series of six affinity purification/mass spectrometry screens
23166591 Interaction of HIV-1 Gag with signal recognition particle 14kDa (SRP14, homologous Alu RNA binding protein) is identified in a series of six affinity purification/mass spectrometry screens
20348448 mutational study on SRP9/14 that identified and characterized regions and single residues essential for elongation arrest activity
18455985 SRP14 mutant proteins with absence of a peptide elongation delay caused inefficient targeting of preproteins leading to defects in secretion, depletion of proteins in the endogenous membranes, and reduced cell growth.

AA Sequence

MVLLESEQFLTELTRLFQKCRTSGSVYITLKKYDGRTKPIPKKGTVEGFEPADNKCLLRATDGKKKISTV      1 - 70
VSSKEVNKFQMAYSNLLRANMDGLKKRDKKNKTKKTKAAAAAAAAAPAAAATAPTTAATTAATAAQ         71 - 136
//

Text Mined References (30)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25697503 2015 Alu RNA regulates the cellular pool of active ribosomes by targeted delivery of SRP9/14 to 40S subunits.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22720776 2012 PHF6 interacts with the nucleosome remodeling and deacetylation (NuRD) complex.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22327514 2012 Common variants near TARDBP and EGR2 are associated with susceptibility to Ewing sarcoma.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
20348448 2010 Residues in SRP9/14 essential for elongation arrest activity of the signal recognition particle define a positively charged functional domain on one side of the protein.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
18455985 2008 SRP keeps polypeptides translocation-competent by slowing translation to match limiting ER-targeting sites.
18089836 2008 A new mechanism of 6-((2-(dimethylamino)ethyl)amino)-3-hydroxy-7H-indeno(2,1-c)quinolin-7-one dihydrochloride (TAS-103) action discovered by target screening with drug-immobilized affinity beads.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11089964 2000 Structure and assembly of the Alu domain of the mammalian signal recognition particle.
9016560 1997 The SRP9/14 subunit of the human signal recognition particle binds to a variety of Alu-like RNAs and with higher affinity than its mouse homolog.
8196634 1994 A human Alu RNA-binding protein whose expression is associated with accumulation of small cytoplasmic Alu RNA.
7542942 1995 The SRP9/14 subunit of the signal recognition particle (SRP) is present in more than 20-fold excess over SRP in primate cells and exists primarily free but also in complex with small cytoplasmic Alu RNAs.
2557625 1989 Isolation of a cDNA clone of the 14-kDa subunit of the signal recognition particle by cross-hybridization of differently primed polymerase chain reactions.
2153922 1990 Assembly of the Alu domain of the signal recognition particle (SRP): dimerization of the two protein components is required for efficient binding to SRP RNA.