Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.14
PubTator Score 1.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count P-value
psoriasis 6694 3.3e-17
Astrocytoma, Pilocytic 3081 1.6e-05
sonic hedgehog group medulloblastoma 467 9.8e-05
Disease Target Count Z-score Confidence
Brain infarction 22 0.0 1.9
Disease Target Count Z-score Confidence
Townes-Brocks syndrome 15 4.518 2.3
Amnestic disorder 35 3.14 1.6
Brucellosis 24 3.117 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 1.6e-05
psoriasis -1.200 3.3e-17
sonic hedgehog group medulloblastoma 1.300 9.8e-05

Gene RIF (1)

AA Sequence

MGQKLSGSLKSVEVREPALRPAKRELRGAEPGRPARLDQLLDMPAAGLAVQLRHAWNPEDRSLNVFVKDD      1 - 70
DRLTFHRHPVAQSTDGIRGKVGHARGLHAWQINWPARQRGTHAVVGVATARAPLHSVGYTALVGSDAESW     71 - 140
GWDLGRSRLYHDGKNQPGVAYPAFLGPDEAFALPDSLLVVLDMDEGTLSFIVDGQYLGVAFRGLKGKKLY    141 - 210
PVVSAVWGHCEVTMRYINGLDPEPLPLMDLCRRSIRSALGRQRLQDISSLPLPQSLKNYLQYQ           211 - 273
//

Text Mined References (11)

PMID Year Title