Property Summary

NCBI Gene PubMed Count 17
PubMed Score 9.15
PubTator Score 491.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Stomach Neoplasms 300 0.0 0.0
Disease Target Count Z-score Confidence
Ichthyosis vulgaris 11 3.221 1.6

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 2.2e-03
cystic fibrosis 3.200 8.2e-06
head and neck cancer 2.000 2.7e-02
lung cancer -4.800 6.8e-03
medulloblastoma, large-cell 1.400 9.1e-05
nasopharyngeal carcinoma -1.900 3.4e-03
non-small cell lung cancer 4.165 2.6e-10
psoriasis 2.700 3.8e-49

Gene RIF (5)

AA Sequence

MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQSKYPPK      1 - 70
SK                                                                         71 - 72
//

Text Mined References (18)

PMID Year Title