Property Summary

NCBI Gene PubMed Count 8
PubMed Score 40.53
PubTator Score 95.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

Gene RIF (2)

AA Sequence

MAGSDTAPFLSQADDPDDGPVPGTPGLPGSTGNPKSEEPEVPDQEGLQRITGLSPGRSALIVAVLCYINL      1 - 70
LNYMDRFTVAGVLPDIEQFFNIGDSSSGLIQTVFISSYMVLAPVFGYLGDRYNRKYLMCGGIAFWSLVTL     71 - 140
GSSFIPGEHFWLLLLTRGLVGVGEASYSTIAPTLIADLFVADQRSRMLSIFYFAIPVGSGLGYIAGSKVK    141 - 210
DMAGDWHWALRVTPGLGVVAVLLLFLVVREPPRGAVERHSDLPPLNPTSWWADLRALARNPSFVLSSLGF    211 - 280
TAVAFVTGSLALWAPAFLLRSRVVLGETPPCLPGDSCSSSDSLIFGLITCLTGVLGVGLGVEISRRLRHS    281 - 350
NPRADPLVCATGLLGSAPFLFLSLACARGSIVATYIFIFIGETLLSMNWAIVADILLYVVIPTRRSTAEA    351 - 420
FQIVLSHLLGDAGSPYLIGLISDRLRRNWPPSFLSEFRALQFSLMLCAFVGALGGAAFLGTAIFIEADRR    421 - 490
RAQLHVQGLLHEAGSTDDRIVVPQRGRSTRVPVASVLI                                    491 - 528
//

Text Mined References (17)

PMID Year Title