Property Summary

NCBI Gene PubMed Count 71
PubMed Score 497.97
PubTator Score 141.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Hypotrichosis 47 0.0 4.0
Disease Target Count
Asthma, susceptibility to 11

Expression

  Differential Expression (13)

Disease log2 FC p
colon cancer -2.000 1.6e-02
cystic fibrosis 2.500 1.2e-03
esophageal adenocarcinoma -3.500 3.0e-02
intraductal papillary-mucinous adenoma (... 2.800 1.2e-03
intraductal papillary-mucinous carcinoma... 2.300 1.6e-02
intraductal papillary-mucinous neoplasm ... 3.100 2.3e-03
lung cancer -1.700 2.0e-04
medulloblastoma, large-cell 1.200 1.4e-04
nasopharyngeal carcinoma -2.200 2.5e-04
pancreatic cancer 1.200 2.4e-02
psoriasis 1.300 3.3e-04
Rhinitis 1.200 4.4e-02
spina bifida -1.921 3.5e-02

Gene RIF (66)

AA Sequence

MKIATVSVLLPLALCLIQDAASKNEDQEMCHEFQAFMKNGKLFCPQDKKFFQSLDGIMFINKCATCKMIL      1 - 70
EKEAKSQKRARHLARAPKATAPTELNCDDFKKGERDGDFICPDYYEAVCGTDGKTYDNRCALCAENAKTG     71 - 140
SQIGVKSEGECKSSNPEQDVCSAFRPFVRDGRLGCTRENDPVLGPDGKTHGNKCAMCAELFLKEAENAKR    141 - 210
EGETRIRRNAEKDFCKEYEKQVRNGRLFCTRESDPVRGPDGRMHGNKCALCAEIFKQRFSEENSKTDQNL    211 - 280
GKAEEKTKVKREIVKLCSQYQNQAKNGILFCTRENDPIRGPDGKMHGNLCSMCQAYFQAENEEKKKAEAR    281 - 350
ARNKRESGKATSYAELCSEYRKLVRNGKLACTRENDPIQGPDGKVHGNTCSMCEVFFQAEEEEKKKKEGK    351 - 420
SRNKRQSKSTASFEELCSEYRKSRKNGRLFCTRENDPIQGPDGKMHGNTCSMCEAFFQQEERARAKAKRE    421 - 490
AAKEICSEFRDQVRNGTLICTREHNPVRGPDGKMHGNKCAMCASVFKLEEEEKKNDKEEKGKVEAEKVKR    491 - 560
EAVQELCSEYRHYVRNGRLPCTRENDPIEGLDGKIHGNTCSMCEAFFQQEAKEKERAEPRAKVKREAEKE    561 - 630
TCDEFRRLLQNGKLFCTRENDPVRGPDGKTHGNKCAMCKAVFQKENEERKRKEEEDQRNAAGHGSSGGGG    631 - 700
GNTQDECAEYREQMKNGRLSCTRESDPVRDADGKSYNNQCTMCKAKLEREAERKNEYSRSRSNGTGSESG    701 - 770
KDTCDEFRSQMKNGKLICTRESDPVRGPDGKTHGNKCTMCKEKLEREAAEKKKKEDEDRSNTGERSNTGE    771 - 840
RSNDKEDLCREFRSMQRNGKLICTRENNPVRGPYGKMHINKCAMCQSIFDREANERKKKDEEKSSSKPSN    841 - 910
NAKDECSEFRNYIRNNELICPRENDPVHGADGKFYTNKCYMCRAVFLTEALERAKLQEKPSHVRASQEED    911 - 980
SPDSFSSLDSEMCKDYRVLPRIGYLCPKDLKPVCGDDGQTYNNPCMLCHENLIRQTNTHIRSTGKCEESS    981 - 1050
TPGTTAASMPPSDE                                                           1051 - 1064
//

Text Mined References (73)

PMID Year Title