Property Summary

NCBI Gene PubMed Count 4
PubMed Score 4.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Synonym

Accession Q56A73 B3KX90 Q5JUL2
Symbols TDRD28

Gene

PDB

4UY4  

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

 GO Process (1)

AA Sequence

MSPPTVPPMGVDGVSAYLMKKRHTHRKQRRKPTFLTRRNIVGCRIQHGWKEGNEPVEQWKGTVLEQVSVK      1 - 70
PTLYIIKYDGKDSVYGLELHRDKRVLALEILPERVPTPRIDSRLADSLIGKAVEHVFEGEHGTKDEWKGM     71 - 140
VLARAPVMDTWFYITYEKDPVLYMYTLLDDYKDGDLRIIPDSNYYFPTAEQEPGEVVDSLVGKQVEHAKD    141 - 210
DGSKRTGIFIHQVVAKPSVYFIKFDDDIHIYVYGLVKTP                                   211 - 249
//

Text Mined References (6)

PMID Year Title