Property Summary

NCBI Gene PubMed Count 4
PubMed Score 4.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

 GO Process (1)

AA Sequence

MSPPTVPPMGVDGVSAYLMKKRHTHRKQRRKPTFLTRRNIVGCRIQHGWKEGNEPVEQWKGTVLEQVSVK      1 - 70
PTLYIIKYDGKDSVYGLELHRDKRVLALEILPERVPTPRIDSRLADSLIGKAVEHVFEGEHGTKDEWKGM     71 - 140
VLARAPVMDTWFYITYEKDPVLYMYTLLDDYKDGDLRIIPDSNYYFPTAEQEPGEVVDSLVGKQVEHAKD    141 - 210
DGSKRTGIFIHQVVAKPSVYFIKFDDDIHIYVYGLVKTP                                   211 - 249
//

Text Mined References (6)

PMID Year Title