Property Summary

NCBI Gene PubMed Count 252
PubMed Score 1078.87
PubTator Score 714.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
urothelial carcinoma 318 1.4e-12
juvenile dermatomyositis 1189 5.9e-09
posterior fossa group A ependymoma 1511 6.0e-09
pilocytic astrocytoma 3086 1.3e-08
Duchenne muscular dystrophy 602 4.5e-08
pediatric high grade glioma 2712 2.3e-06
ovarian cancer 8491 3.9e-06
nasopharyngeal carcinoma 1056 4.8e-06
atypical teratoid / rhabdoid tumor 4369 9.4e-06
pancreatic cancer 2300 1.8e-05
ulcerative colitis 2087 2.3e-05
limb girdle muscular dystrophy 2A 156 8.1e-05
primary pancreatic ductal adenocarcinoma 1271 8.6e-05
cystic fibrosis 1670 1.4e-04
pancreatic carcinoma 567 1.9e-04
group 4 medulloblastoma 1875 5.4e-04
medulloblastoma, large-cell 6234 5.7e-04
Down syndrome 548 8.3e-04
intraductal papillary-mucinous adenoma (IPMA) 2956 9.6e-04
astrocytoma 1493 1.7e-03
invasive ductal carcinoma 2950 2.1e-03
oligodendroglioma 2849 2.4e-03
hepatocellular carcinoma 550 3.0e-03
intraductal papillary-mucinous carcinoma (IPMC) 2988 3.0e-03
Atopic dermatitis 944 3.5e-03
primitive neuroectodermal tumor 3031 5.6e-03
acute myeloid leukemia 785 5.7e-03
gastric carcinoma 832 6.6e-03
inflammatory breast cancer 404 7.0e-03
glioblastoma 5572 1.1e-02
Becker muscular dystrophy 187 1.2e-02
pterygium 74 2.2e-02
esophageal adenocarcinoma 737 2.3e-02
autosomal dominant Emery-Dreifuss muscular dystrophy 499 2.8e-02
chronic kidney disease 90 3.6e-02
subependymal giant cell astrocytoma 2287 3.8e-02
intraductal papillary-mucinous neoplasm (IPMN) 3289 4.5e-02
primary Sjogren syndrome 788 4.9e-02
Disease Target Count
Osteogenesis imperfecta 17 1

Expression

  Differential Expression (38)

Disease log2 FC p
gastric carcinoma 2.700 6.6e-03
hepatocellular carcinoma 1.200 3.0e-03
pancreatic cancer 4.000 1.8e-05
urothelial carcinoma 3.900 1.4e-12
astrocytoma 3.300 1.7e-03
oligodendroglioma 3.200 2.4e-03
esophageal adenocarcinoma 1.400 2.3e-02
glioblastoma 2.400 1.1e-02
posterior fossa group A ependymoma 1.400 6.0e-09
atypical teratoid / rhabdoid tumor 1.400 9.4e-06
medulloblastoma, large-cell -1.400 5.7e-04
primitive neuroectodermal tumor 1.100 5.6e-03
Duchenne muscular dystrophy 2.130 4.5e-08
limb girdle muscular dystrophy 2A 1.467 8.1e-05
autosomal dominant Emery-Dreifuss muscul... 1.353 2.8e-02
Becker muscular dystrophy 1.410 1.2e-02
juvenile dermatomyositis 1.463 5.9e-09
Atopic dermatitis -1.200 3.5e-03
chronic kidney disease 1.400 3.6e-02
primary pancreatic ductal adenocarcinoma 3.963 8.6e-05
intraductal papillary-mucinous adenoma (... -3.400 9.6e-04
intraductal papillary-mucinous carcinoma... -3.700 3.0e-03
intraductal papillary-mucinous neoplasm ... -2.700 4.5e-02
cystic fibrosis 2.300 1.4e-04
pediatric high grade glioma 1.600 2.3e-06
group 4 medulloblastoma -1.600 5.4e-04
pilocytic astrocytoma 2.000 1.3e-08
primary Sjogren syndrome 1.300 4.9e-02
pancreatic carcinoma 2.300 1.9e-04
subependymal giant cell astrocytoma 1.551 3.8e-02
nasopharyngeal carcinoma 1.900 4.8e-06
inflammatory breast cancer 1.900 7.0e-03
pterygium 1.300 2.2e-02
invasive ductal carcinoma -1.500 2.1e-03
acute myeloid leukemia -1.900 5.7e-03
ulcerative colitis 2.800 2.3e-05
ovarian cancer -3.600 3.9e-06
Down syndrome 1.300 8.3e-04

Protein-protein Interaction (1)

Gene RIF (207)

PMID Text
27069189 We identified five new biomarkers: GDF15, osteonectin, TRAP5, TWEAK, and YKL40 as being promising markers for monitoring bone metastases.
26731428 SPARC might be an unfavorable indicator in patients with pancreatic cancer, especially in the stroma.[Review]
26656750 tracheal aspirate SPARC levels predicted development of bronchopulmonary dysplasia or death.
26523779 high SPARC-expression was a significant predictor of poor OS in HPV-negative OPSCC patients using Kaplan-Meier analysis and the log-rank test
26335014 Studies indicate that SPARC (secreted protein acidic and rich in cysteine) gene is involved in the development and progression of pancreatic ductal adenocarcinoma (PDAC).
26329007 CD90 is upregulated in gastric cancer and inhibits gastric cancer cell apoptosis by modulating the expression level of SPARC protein.
26169969 SPARC levels were not associated with efficacy in patients with MPC. This exploratory analysis does not support making treatment decisions regarding nab-paclitaxel plus gemcitabine or gemcitabine alone in MPC based on SPARC expression.
26165695 MLKL upregulation in SPARC overexpressed cells treated with Ara-C, indicates necrosis as a possible cell death process for the SKM-1 cells under these stringent conditions.
26044224 Reduced expression of SPARC in colorectal cancer tissue is associated with poor prognosis and aggressive clinicopathological features.
26027498 Recessive osteogenesis imperfecta caused by missense mutations in SPARC.
26025968 up-regulation of SPARC by oxLDL is independent of Runx2, and it may be mediated by other transcription factors
25925867 Tumor-produced SPARC and VCAM1 are regulators of cancer extravasation.
25802234 SCD5 impairs SPARC and cathepsin B secretion in human melanoma cells and intracellular pH acidification.
25786138 miR-29a and miR-29b enhance cell migration and invasion in nasopharyngeal carcinoma progression by regulating SPARC and COL3A1 gene expression.
25556322 We conclude that SPARC expression has no effect on progression or invasiveness of pituitary tumors.
25516351 SPARC promoter methylation as an important factor in the tumorigenesis of gastric carcinomas.
25374228 High SPARC expression is associated with non-small cell lung cancer.
25355716 High SPARC expression of the primary tumor is associated with a higher chance of achieving a pathological complete remission after TAC or TAC-NX chemotherapy.
25331979 The matricellular protein SPARC, secreted by a prostate cancer clonal tumor cell subpopulation displaying non-cancer stem cell properties, is a critical mediator of paracrine effects.
25311631 SPARC is associated with carcinogenesis of oral squamous epithelium.
25262637 SNP1599 differentially regulates osteonectin expression and contributes to variability in bone mass, by a mechanism that may involve differential targeting by miR-433
25252848 A novel function of SPARC in the regulation of glucose metabolism in hepatocellular carcinoma.
25155283 SPARC expression inperi-tumoralstroma predicts a poor prognosis for patients with biliary tract cancer after surgery
25126876 Three functional SPARC SNPs are associated with an increased risk of coal workers' pneumoconiosis in a Chinese population.
25032754 reduced expression in the bone marrow biopsy specimen in patients with aplastic anemia
25027401 SPARC is downregulated in pancreatic cancer cells and retards the growth of pancreatic cancer cell
24993904 data strongly support the hypothesis that SPARC is involved in directing melanoma metastases specifically to the lung
24804200 Effect of cyclic mechanical stimulation on the expression of osteogenesis genes in human intraoral mesenchymal stromal and progenitor cells.
24769035 This is the first report of overexpression of SPARC in endometrial cancer stem-like cells. SPARC expression is associated with cell migration and stroma formation
24754275 This study indicates that polymorphisms in SPARC and NLRP2 are related to rheumatoid arthritis susceptibility in a Chinese Han population.
24676680 SPARC expression was negatively correlated with clinicopathological factors of gastric cancer
24590286 SPARC overexpression is associated with adverse outcome in cytogenetically normal-AML, and secreted SPARC activates the integrin-linked kinase/AKT pathway, likely via integrin and beta-catenin signaling, which is involved in leukemia cell self-renewal.
24562449 SPARC expression is a predictive marker for response to gemcitabine in pancreatic cancer.
24535175 SPARC acts as an oncogene in transformed myelodysplastic syndrome/acute myeloid leukemia.
24474275 our data identify lovastatin as an important pharmacological suppressor of SPARC expression in TM cells, and provide further insight into the molecular mechanisms mediating statin enhancement of aqueous outflow facility.
24396828 The study demonstrated a prognostic value of SPARC, especially with regard to its expression in the stroma surrounding OSCC (P < 0.05
24349098 SPARC has a potential role in the pathophysiology of gestational diabetes mellitus.
24309322 These results indicate that promoter methylation status of PCDH10, SPARC, and UCHL1 may be used both as prognostic and predictive molecular marker for colorectal cancer patients
24018911 Results suggest that overexpression of the SPARC gene correlates with tumor invasion depth and survival in gastric cancer.
23935929 SPARC may play an important role in the regulation of normal placentation by promoting the invasion of trophoblast cells into the uterine decidua.
23904381 Down-regulated expression of ET3 attenuates the malignant behaviors of human melanoma cells partially by decreasing the expression of SPARC.
23846918 Studies indicate that HENT1 and SPARC expression seem to be useful predictive factors of response to chemotherapy in pancreatic cancer.
23846421 coexpression of DCX and SPARC collaboratively diminished radioresistance of glioma cells.
23840838 Overexpression of SPARC in cultured beta-cells resulted in a 2.4-fold increase in insulin secretion in high glucose conditions.
23666856 SPARC may contribute to the metabolic dysregulation associated with obesity in humans.
23648679 We observed a positive correlation of osteonectin expression in connective-type stromal tissue surrounding the epithelial tumor cells of craniopharyngioma with the extent of central nervous system infiltration and recurrence rate
23638089 This analysis suggests a potential role of SPARC in determining prognosis and response to primary chemotherapy in early breast cancer.
23599341 SPARC overexpression increases IOP in perfused cadaveric human anterior segments resulting from a qualitative change the juxtacanalicular-extracellular matrix.
23532895 The interaction between SPARC and integrin beta1 results in suppression of cell proliferation in prostate cancer.
23516489 role of SPARC, MMP-2 and MMP-9 in intracranial aneurysms
23390502 MiR-145 regulates glioma cell migration by targeting CTGF which downregulates SPARC expression.
23383963 Low endogenous SPARC expression is a constant feature of BCR/ABL positive cells and that imatinib treatment induces SPARC overproduction.
23321672 SPARC is produced by benign and malignant compartments of bladder carcinomas where it functions to suppress bladder carcinogenesis, progression, and metastasis.
23249717 Data indicat that the SPARC overexpression may play an important role in the initiation and development of non-small cell lung cancer (NSCLC), whereas KLF4 inhibits this process.
23123816 High secreted protein acidic and rich in cysteine induces endoplasmic reticulum stress leading to autophagy-mediated apoptosis in neuroblastoma.
23114088 SPARC expression is higher in squamous cell carcinoma than in adenocarcinoma in non-small cell lung cancer. SPARC was a prognostic factor of overall survival but not disease-free survival.
23050783 SPARC is related to the invasive phenotype of cervical cancer cells. Knockdown of SPARC significantly suppresses cervical cancer cell proliferation, induces cell apoptosis and inhibits cell invasion and metastasis.
23023935 Expression of miR-29a is important in the regulation of the SPARC gene expression and hepatocellular carcinoma growth.
22957090 SPARC suppresses angiogenesis of gastric cancer by down-regulating the expression of VEGF and MMP-7
22956186 Conditioned medium from SPARC-overexpressed neuroblastoma cells (pSPARC-CM) suppressed expression of growth factors was mediated by inhibition of the Notch signaling pathway.
22955913 Stromal SPARC contributes to the detrimental fibrotic changes associated with myeloproliferation whereas its deficiency favors myeloid cell expansion.
22911700 autocrine SPARC maintains heightened SLUG expression in melanoma cells and indicate that SPARC may promote EMT-associated tumor invasion by supporting AKT-dependent upregulation of SLUG.
22880013 The spatio-temporal expression of Decorin, Semaphorin6D, SPARC, Spry-1 and Tsukushi in developing prostate is described and observed similar mesenchymal expression patterns in rat and human.
22879971 SPARC is overexpressed in highly invasive subclone and ovarian cancer tissues and plays an important role in ovarian cancer growth, apoptosis and metastasis.
22851666 These findings suggest that exercise stimulates SPARC secretion from muscle tissues and that SPARC inhibits colon tumorigenesis by increasing apoptosis.
22718352 IRE1alpha is a key regulator of SPARC expression in vitro in a glioma model.
22687753 SPARC promotes the development of erythroid progenitors, but does not affect terminal erythroid differentiation.
22567126 Results establish SPARC as an effector of AKT-PTEN-mediated inhibition of proliferation in neuroblastoma in vitro and in vivo.
22563191 Aberrant methylation is an important mechanism for SPARC inactivation in hepatocellular carcinoma (HCC) and SPARC methylation may be a promising biomarker for the diagnosis and prognosis of HCC.
22542805 demonstrate that SPARC expression suppressed irradiation induced SOX-4 mediated DNA repair
22491017 Our findings suggest that SPARC 3'-UTR SNPs may be useful in predicting GA patients at increased risk of recurrence.
22422640 Data show that SFN and SPARC form a complex thereby controlling the type I collagen synthesis and expression in fibroblasts.
22321704 SPARC expression is common in nasopharyngeal carcinoma patients.
22308039 beta4 can regulate SPARC expression and that SPARC is an effector of beta4-mediated invasion.
22247475 cells grown on TCP produced greater or similar amounts of SPARC and myocilin mRNA after Lat-B treatment. SPARC and myocilin protein expression paralleled changes in mRNA expression.
22246794 Low SPARC expression is associated with gastric cancer angiogenesis.
22222271 SPARC was upregulated in pterygium and may collaborate with increased MMP-3 in some patients to account for many of the phenotypic properties characteristic of pterygium.
22206672 Taken together our studies further reveal that STAT3 plays a key role in SPARC induced G2/M arrest in medulloblastoma cells.
22145659 Inhibition of SPARC expression may diminish the radiosensitivity of human glioma U-87MG cells.
22136411 SPARC modulates the expression of several extracellular matrix genes in cultured human trabecular meshwork cells.
22114076 Loss of the EGF-like module suppresses the enhanced HSP27 protein stability conferred by SPARC.
22003835 To human epithelial ovarian cancer, SPARC was expressed by the tumor cells but was absent in reactive stroma of WT mice.
21976959 Novel and already reported variants were identified in SPARC and SOD1, whose pathogenic significance has not been established in Italian patients with keratoconus.
21962567 follicular dendritic cell networking toward Th17 responses
21922274 APAF-1, DAPK-1 and SPARC may have a role in progression and higher tumor stage of renal cell carcinoma in North Indian population
21867537 DNA methylation down-regulates SPARC expression in chronic low back pain (LBP) in pre-clinical models and in patients with chronic LBP.
21850018 Analysis of the data led to the elucidation of a new molecular mechanism by which SPARC promotes cathepsin B-mediated melanoma invasiveness using collagen I and alpha2beta1 integrins as mediators.
21818290 The aim was to determine if SPARC, FOXP3, CD8 and CD45RO expression levels are associated with colorectal cancer (CRC) stage, disease outcome and long-term cancer-specific survival
21801304 SPARC knockdown in human Tenon's fibroblasts modulates fibroblast functions important for wound fibrosis.
21798346 SPARC mediates Src-induced disruption of actin cytoskeleton via inactivation of small GTPases Rho-Rac-Cdc42
21778250 The present work indicates a potential link between SPARC and the pathogenesis of type 2 diabetes mellitus
21725199 Stromal cell SPARC expression is epigenetically influenced by lymphovascular invasion of colorectal cancer (CRC) tumors, and may play a significant role in primary CRC progression.
21685937 SPARC has a cell-autonomous survival activity, which requires Akt-dependent regulation of p53
21672357 The relationship between SPARC and HbA(1c) may merit further investigation with regard to its association with postprandial or long-term glucose variation in obese male subjects.
21339733 This novel TP53INP1 activity on the regulation of SPARC expression could explain in part its tumor suppressor function in pancreatic adenocarcinoma by modulating cellular spreading during the metastatic process
21308731 Studies identified a binding site on SPARC for stabilin-1 by a solid-state peptide array coupled with a modified enzyme-linked immunosorbent assay.
21264231 SPARC is highly expressed in scarred human Tenon's capsules in vivo and can directly induce and amplify the effect of TGF-beta on HTF cell proliferation and collagen gel contraction in vitro
21192846 Laminin-5 gamma2 chain and SPARC may play roles in the progression of esophageal squamous cell carcinoma and their simultaneous expression is correlated with poorer prognosis.
21173124 More aggressive chemotherapy protocols should be considered for patients with activated B-cell-type diffuse large B-cell lymphoma without SPARC+ stromal cells.
21152079 Data show that expression of SPARC and SPP1 was significantly associated with OS of EAC patients.
21098700 Results highlight an important role for the Fyn/ERK signaling pathway in imatinib-resistant cells that is driven by accumulation of intracellular SPARC.
21042566 The coding sequences, splice sites and copy number of SPARC do not contribute to juvenile-onset primary open-angle glaucoma.
21042566 Observational study of gene-disease association. (HuGE Navigator)
20955243 SPARC regulates, in a cell-autonomous manner, cell cycle progression and proliferation through the p53/p21(Cip1/Waf1) pathway.
20929508 Relevance of secreted protein acidic and rich in cysteine in the etiopathophysiology of diabetic nephropathy
20673868 Observational study of gene-disease association. (HuGE Navigator)
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20607658 Our results suggest that human retinal pigment epithelial cell SPARC levels decline with age
20606036 The higher methylation of SPARC genes in prostate tissue samples from AA in comparison with Cau and may potentially contribute to the racial differences that are observed in prostate cancer pathogenesis.
20574156 in ductal carcinoma in situ (DCIS) patients a significant association was observed between recurrence status and time to recurrence with expression of CD10 and SPARC;stromal CD10 and SPARC expression are new markers of increased risk for DCIS recurrence
20565704 Low expression or absence of stromal SPARC was associated with colon cancer.
20525171 Overexpression of SPARC is associated with gastric cancer cellular invasion and survival.
20452482 Observational study of gene-disease association. (HuGE Navigator)
20393008 High SPARC mRNA expression was associated with a poorer prognosis than low SPARC in pancreatic adenocarcinoma.
20369286 SPARC down-regulation is associated with breast cancer.
20339379 SPARC expression induces autophagy, which results in the elevation of cathepsin B and subsequent mitochondria-mediated apoptosis.
20338068 Methylation of the SPARC gene, specifically CpG Region 2, may be an early event during pancreatic tumorigenesis
20210803 Invasive ductal carcinoma of breast with positive SPARC expression had 2.34 times higher hazard of death compared with those with negative SPARC expression.
20195270 This Review is focused on whether SPARC could be a key player in the pathology of obesity and its related metabolic complications.
20132490 SPARC is highly expressed in astrocytomas and decreases with tumour progression; increased SPARC expression is associated with decreased proliferation; increased tumour vascular SPARC expression is associated with decreased patient survival
20087345 Overexpression of SPARC decreases angiogenesis, which leads to decreased tumour growth. Further, the role of MMP-9 could be attributed to the anti-angiogenic effect of SPARC.
20070483 expression level of SPARC statistically correlated with MMP-9 but not with MMP-1 or -2 in ameloblastoma. Results suggest putative association between SPARC and MMPs (especially MMP-9) in ameloblastoma to regulate tumor invasion.
20061390 idiopathic pulmonary fibrosis fibroblasts constitutively expressed increased basal levels of SPARC, plasminogen activator inhibitor-1 (PAI-1), and active beta-catenin compared with control cells
19920824 Endogenous SPARC expression can be modulated by FGFR1-III isoform expression. Endogenous SPARC expression in PANC-1 cells was increased in FGFR1-IIIb over-expressing cells, but decreased in FGFR1-IIIc over-expressing cells.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19900269 Our observations are the first to implicate SPARC, SLPI, and NLRP2, a component of the innate immune system, in the pathogenesis of axial spondyloarthropathy
19830689 SPARC overexpression in human hepatocellular carcinoma cells inhibits tumorigenic capacity and increases survival.
19817957 Identify a SNP in the SPARC gene correlating to hepatocellular carcinoma susceptibility.
19817957 Observational study of gene-disease association. (HuGE Navigator)
19780053 The expression levels of four of the up-regulated genes, CXCL1, SPARC, SPP1 and SULF, were significantly higher in the cancerous tissue compared with the normal tissue (fold change 3.4-8.9).
19703125 A high immunohistochemical score for SPARC was more frequent in atypical and in anaplastic meningiomas than in benign meningiomas (p < 0.01).
19700761 role of bone marrow cathepsin K in regulation of biological activity of SPARC in bone metastasis
19661316 High SPARC is associated with uveal melanoma.
19597474 Findings demonstrate that both tumor and stromal SPARC are limiting for primary prostate tumorigenesis and progression, through effects on the cell cycle and the creation of a less favorable tumor microenvironment.
19509023 SPARC expression is predominant in subcutaneous fat and its expression and secretion in adipose tissue are influenced by fat mass, leptin, insulin, and glucose.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19448421 SPARC is highly expressed in stage II tongue squamous cell carcinoma, and positively correlated to survival, occult lymph node metastasis and recurrence.
19403984 SPARC is highly expressed in eyes in proliferative diabetic retinopathy
19236378 APN expression and enzymatic function is reduced in aggressive meningiomas, and that alterations in the balance between APN and SPARC might favor meningioma invasion
19177197 The results implicate Sparc promoter methylation as an important factor in the genesis and survival of ovarian carcinomas and provide new insights into the potential use of SPARC as a novel biomarker and/or treatment modality for this disease.
18949063 SPARC was significantly increased in the primary angle closure glaucoma iris.
18813945 SPARC expression appears to be closely related to malignancy in melanocytic lesions.
18813349 The effects of tumor SPARC as a negative regulator of ovarian cancer are mediated through decreased recruitment of macrophages and downregulation of the associated inflammation.
18796407 This study shows SPARC expression both during muscle development and in regenerating muscle. The expression is detected both in satellite cells/myoblasts and in myotubes and muscle fibers, indicating a role for SPARC in the skeletal muscle compartment.
18787407 analysis of SPARC expression and patient survival after chemoradiation for non-resectable pancreatic adenocarcinoma
18583538 SPARC-mediated mobilization of adipose stromal (stem) cells through its effect on alpha5beta1 integrin complex provides a functional basis for the regulation of white adipose tissue body composition by SPARC.
18487610 SPARC might modulate collagen fibril assembly in vivo.
18442089 Expression of SPARC is associated with elongated cell morphology, and increased migration and invasion.
18442048 SPARC subcellular localization in the human osteoblastic HOBIT cell line was investigated by immunocytochemistry and western blot analysis.
18410576 could play a crucial role in dental pulp tissue repair by inducing dental pulp cell migration via extracellular signal-regulated kinase
18367635 Data show that the nonsteroidal anti-inflammatory drug NS398 reactivates SPARC expression via promoter demethylation to attenuate invasiveness of lung cancer cells.
18350569 experiments implicate a novel mechanism, whereby SPARC regulates VEGF function by limiting the available growth factor
18253934 analysis of the role of SPARC in tumor progression [review]
18084690 Osteonectin regulates skeletal remodeling and bone mass in animals, and haplotypes in the 3' UTR of this gene are associated with bone density in Caucasian men with idiopathic osteoporosis.
18084690 Observational study of gene-disease association. (HuGE Navigator)
18059024 Malignant cells expressing or not expressing SPARC developed alternative mechanisms that, in contrary to stromal cells, rendered them SPARC-insensitive. Overexpression of SPARC by melanoma cells renders them resistant to the effect of exogenous SPARC.
17994631 Transient re-expression of SPARC in SPARC-downregulated melanoma cells reverted extracellular N-CAD, CLU, and HSP27 to levels similar to those in the control.
17970686 Observational study of gene-disease association. (HuGE Navigator)
17970686 No association between SPARC gene polymorphism and gingival overgrowth was revealed in kidney transplant patients who were administered CsA.
17724718 Central role for Osteonectin in the regulation of gene expression changes driving the progression of melanoma toward metastasis.
17681430 Therapeutic targeting of SPARC in nasopharyngeal angiofibroma would be targeting of a molecule at the roots of cooperation between stromatogenesis and angiogenesis
17638862 p45-sErbB3 may mediate the bidirectional interactions between prostate cancer cells and bone via osteonectin
17625595 Melanoma growth is not subject to regulation by exogenous SPARC, nor by stromal organization, but only by SPARC levels produced by the malignant cells themselves.
17586526 The motif of SPARC that inhibits the synthesis of urothelial cell DNA is not a nuclear localization signal
17490812 Our results suggest that their upregulation and activation may be a consequence of increased SPARC expression. These data provide a provisional mechanism whereby SPARC contributes to brain tumor invasion.
17487382 Accumulation of SPARC protein in most tumors compared to normal tissues (p<0.025), suggests an important role in the carcinogenesis of endometrial tumors.
17435158 A negative association is noted for alveolar bone loss and salivary osteonectin in postmenopausal women.
17397030 The results indicate that epigenetic gene silencing of SPARC is frequent in colon cancers, and that inactivation of SPARC is related to rapid progression of colon cancers.
17343824 Results show for the first time that forced-expression of SATB1 in K562 cells triggers SPARC up-regulation by binding to a 17bp DNA sequence in the third intron.
17235047 The expression of SPARC by peritumoral fibroblasts portends a poorer prognosis for patients with pancreatic cancer
17213807 data further demonstrate the role of SPARC in glioma tumor progression through the activation of intracellular kinases that may provide novel therapeutic targets for advanced cancers
17022822 High levels of SPARC are not required for tumor progression, but are necessary for tumor growth and maintenance.
16972886 destruction of the basement membrane and appearance of SPARC+ spindle cells are not coincident during the course of brain invasion by meningiomas
16735494 Results suggest a possible role for secreted protein, acidic, cysteine-rich (SPARC) in development of functional and/or structural zonation of the human fetal adrenal
16670288 Clearance of SPARC from the extracellular space by alternatively activated macrophages regulates tissue remodeling and extracellular matrix synthesis.
16299239 SPARC or its combination with glypican-3 is considered a potentially useful tumor marker, especially for melanoma at an early stage.
16263253 Data show that SPARC binds to plasmin-cleaved fibrinogen, but not to native fibrinogen.
16173048 We concluded that osteonectin was not a chemotactic factor. However, through its anti-adhesive properties, osteonectin induced undirected breast cancer cell motility, and may have enhanced chemoattraction to vitronectin.
16121393 Data suggest that the motif of SPARC responsible for anti-spreading activity is dependent on the coordination of calcium by a glutamate residue at the Z position of EF-hand 2.
16012759 Results show that SPARC can be a beneficial prognostic marker for the stage II tongue carcinoma, of which clinical outcomes are sometimes difficult to predict.
15838642 it was concluded that secreted protein acid rich in cysteine(SPARC) overexpression is a constant and functionally important feature of invasive ductal carcinomas of the breast
15795937 expression of SPARC in fibroblasts and endothelial cells derived from young donors and old donors decreased 1.6 to 2.3-fold with age
15763439 gamma linolenic acid is a regulator of SPARC secretion and expression in cancer cells
15763438 SPARC plays a crucial role in tumour development in breast cancer
15641096 TGFbeta1 can induce increased expression of both SPARC and type I collagen. Specific inhibition of SPARC led to decreased expression of type I collagen and attenuated the profibrotic effect of TGFbeta1 in cultured normal human fibroblasts.
15558074 Overexpression of SPARC gene is associated with human gastric carcinoma
15546965 Observational study of gene-disease association. (HuGE Navigator)
15480132 SPARC was measured in discs of subjects aged 0-76 years. SPARC may have an unrecognized role in disc remodeling, aging, and degeneration.
15469933 SPARC expression increases glioma cell survival under stress initiated by serum withdrawal through a decrease in apoptosis.
15389586 New insights into matricellular trafficking of SPARC. Intra- and extra-cellular localization patterns may influence development, homeostasis, and differentiation of transitional epithelium.
15246191 Increased osteonecrin expression is associated with malignant cell transformation of the lung.
15014008 High SPARC expression showed a trend toward longer survival in non-small cell lung cancer.
14500371 In NSCLC, SPARC is selectively synthesized by the cells of the tumoral stroma.
12879219 Observational study of gene-disease association. (HuGE Navigator)
12867428 proteolysis of SPARC by MMP-3 produced peptides that regulate endothelial cell proliferation and influence angiogenesis
12658547 the migration of retinal pigment cells in epiretinal membranes is modulated by TSP1 and SPARC and thus that these two proteins ultimately may represent therapeutic targets in the management of the membranes.
12428242 Observational study of gene-disease association. (HuGE Navigator)
12427131 These studies co-localize SPARC to several sites of renal injury previously shown to be sites of PDGF B-chain expression and/or activity.
12402984 Quantitative analysis of osteonectin mRNA in thyroid carcinomas. Increased expression of osteonectin mRNA was observed in anaplastic carcinoma tissue.
12370830 SPARC plays an important role in stimulating motility and the invasive behavior of c-Jun/MCF7 cells and that SPARC promoter activation by c-Jun appears to occur through an indirect mechanism.
12201246 may have role in remodeling and repair of periodontal tissue by promoting proliferation and matrix metalloproteinase-2 production; may regulate osteoclast formation through osteoprotegerin/osteoclastogenesis inhibitory factor in periodontal ligament cells
12169206 MYCL1, FHIT, SPARC, p16(INK4) and TP53 genes associated to lung cancer in idiopathic pulmoary fibrosis
11856645 osteonectin was present mostly in the nonmineralized predentin.
11782382 Osteonectin/SPARC induction by ectopic beta(3) integrin in human radial growth phase primary melanoma cells.
11716067 SPARC modulates cell growth, attachment and migration of U87 glioma cells on brain extracellular matrix proteins.
11554745 SPARC is induced by VEGF and plays a dual role in the VEGF functions, tumor angiogenesis, and extravasation of tumors mediated by the increased permeability of endothelial barrier function.

AA Sequence

MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAEN      1 - 70
PCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHK     71 - 140
LHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGD    141 - 210
HPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKY    211 - 280
IALDEWAGCFGIKQKDIDKDLVI                                                   281 - 303
//

Text Mined References (254)

PMID Year Title
27069189 2016 Testing of a Novel Cancer Metastatic Multiplex Panel for the Detection of Bone-metastatic Disease - a Pilot Study.
26731428 2016 Prognostic Value of SPARC in Patients with Pancreatic Cancer: A Systematic Review and Meta-Analysis.
26656750 2015 Tracheal Aspirate Levels of the Matricellular Protein SPARC Predict Development of Bronchopulmonary Dysplasia.
26523779 2016 Expression of secreted protein acidic and rich in cysteine is an independent prognostic indicator of a poor clinical outcome in oropharyngeal carcinoma patients.
26335014 2015 SPARC: A Potential Prognostic and Therapeutic Target in Pancreatic Cancer.
26329007 2015 CD90 is upregulated in gastric cancer tissues and inhibits gastric cancer cell apoptosis by modulating the expression level of SPARC protein.
26169969 2015 SPARC Expression Did Not Predict Efficacy of nab-Paclitaxel plus Gemcitabine or Gemcitabine Alone for Metastatic Pancreatic Cancer in an Exploratory Analysis of the Phase III MPACT Trial.
26165695 2015 SPARC ectopic overexpression inhibits growth and promotes programmed cell death in acute myeloid leukemia transformed from myelodysplastic syndrome cells, alone and in combination with Ara-C treatment.
26044224 2015 Secreted protein acidic and rich in cysteine expression in human colorectal cancer predicts postoperative prognosis.
26027498 2015 Recessive osteogenesis imperfecta caused by missense mutations in SPARC.
26025968 2015 Effect of Oxidized Low Density Lipoprotein on the Expression of Runx2 and SPARC Genes in Vascular Smooth Muscle Cells.
25925867 2015 Tumour-derived SPARC drives vascular permeability and extravasation through endothelial VCAM1 signalling to promote metastasis.
25802234 2015 SCD5-induced oleic acid production reduces melanoma malignancy by intracellular retention of SPARC and cathepsin B.
25786138 2015 miR-29a/b enhances cell migration and invasion in nasopharyngeal carcinoma progression by regulating SPARC and COL3A1 gene expression.
25556322 2015 Correlation between SPARC (Osteonectin) expression with immunophenotypical and invasion characteristics of pituitary adenomas.
25516351 2014 Aberrant methylation of the SPARC gene promoter and its clinical implication in gastric cancer.
25374228 2014 Prognostic value of SPARC expression in unresectable NSCLC treated with concurrent chemoradiotherapy.
25355716 2015 Expression of secreted protein acidic and rich in cysteine (SPARC) in breast cancer and response to neoadjuvant chemotherapy.
25331979 2014 SPARC mediates metastatic cooperation between CSC and non-CSC prostate cancer cell subpopulations.
25311631 2015 SPARC is associated with carcinogenesis of oral squamous epithelium and consistent with cell competition.
25262637 2015 A single nucleotide polymorphism in osteonectin 3' untranslated region regulates bone volume and is targeted by miR-433.
25252848 2015 Re-sensitization of 5-FU resistance by SPARC through negative regulation of glucose metabolism in hepatocellular carcinoma.
25155283 2014 Prognostic impact of tumoral and/or peri-tumoral stromal SPARC expressions after surgery in patients with biliary tract cancer.
25126876 2014 Polymorphisms in SPARC and coal workers' pneumoconiosis risk in a Chinese population.
25032754 2015 Reduced expression of osteonectin and increased natural killer cells may contribute to the pathophysiology of aplastic anemia.
25027401 2014 Secreted protein acidic and rich in cysteine inhibits the growth of human pancreatic cancer cells with G1 arrest induction.
24993904 2014 SPARC/osteonectin is involved in metastatic process to the lung during melanoma progression.
24804200 2014 Effect of cyclic mechanical stimulation on the expression of osteogenesis genes in human intraoral mesenchymal stromal and progenitor cells.
24769035 2014 SPARC was overexpressed in human endometrial cancer stem-like cells and promoted migration activity.
24754275 2015 Association of polymorphisms in SPARC and NLRP2 genes with rheumatoid arthritis in a Chinese Han population.
24676680 2014 SPARC expression is negatively correlated with clinicopathological factors of gastric cancer and inhibits malignancy of gastric cancer cells.
24590286 2014 SPARC promotes leukemic cell growth and predicts acute myeloid leukemia outcome.
24562449 2014 SPARC expression in resected pancreatic cancer patients treated with gemcitabine: results from the CONKO-001 study.
24535175 2014 SPARC silencing inhibits the growth of acute myeloid leukemia transformed from myelodysplastic syndrome via induction of cell cycle arrest and apoptosis.
24474275 2014 Pharmacological regulation of SPARC by lovastatin in human trabecular meshwork cells.
24396828 2013 Expression analysis of SPARC/osteonectin in oral squamous cell carcinoma patients: from saliva to surgical specimen.
24349098 2013 Elevated plasma SPARC levels are associated with insulin resistance, dyslipidemia, and inflammation in gestational diabetes mellitus.
24309322 2014 Differential survival trends of stage II colorectal cancer patients relate to promoter methylation status of PCDH10, SPARC, and UCHL1.
24018911 2013 Clinical significance of SPARC gene expression in patients with gastric cancer.
23935929 2013 Downregulation of SPARC expression inhibits the invasion of human trophoblast cells in vitro.
23904381 2013 Silencing endothelin-3 expression attenuates the malignant behaviors of human melanoma cells by regulating SPARC levels.
23846918 2013 Prognostic factors in pancreatic cancer.
23846421 2013 Adenovirus-mediated coexpression of DCX and SPARC radiosensitizes human malignant glioma cells.
23840838 2013 A role for SPARC in the moderation of human insulin secretion.
23666856 2013 Associations among SPARC mRNA expression in adipose tissue, serum SPARC concentration and metabolic parameters in Korean women.
23648679 2013 Osteonectin expression in surrounding stroma of craniopharyngiomas: association with recurrence rate and brain infiltration.
23638089 2013 Association between SPARC mRNA expression, prognosis and response to neoadjuvant chemotherapy in early breast cancer: a pooled in-silico analysis.
23599341 2013 Overexpression of SPARC in human trabecular meshwork increases intraocular pressure and alters extracellular matrix.
23532895 2013 Exogenous SPARC suppresses proliferation and migration of prostate cancer by interacting with integrin ?1.
23516489 2013 The expression of SPARC in human intracranial aneurysms and its relationship with MMP-2/-9.
23390502 2013 MicroRNA-145 is downregulated in glial tumors and regulates glioma cell migration by targeting connective tissue growth factor.
23383963 2013 SPARC expression in CML is associated to imatinib treatment and to inhibition of leukemia cell proliferation.
23321672 2013 Loss of SPARC in bladder cancer enhances carcinogenesis and progression.
23249717 2012 [Correlation of KLF4 and SPARC expression with the clinical characteristics of non-small cell lung cancer].
23123816 2013 The secreted protein acidic and rich in cysteine (SPARC) induces endoplasmic reticulum stress leading to autophagy-mediated apoptosis in neuroblastoma.
23114088 2012 SPARC expression and prognostic value in non-small cell lung cancer.
23050783 2012 Targeting SPARC by lentivirus-mediated RNA interference inhibits cervical cancer cell growth and metastasis.
23023935 2012 microRNA-29a suppresses cell proliferation by targeting SPARC in hepatocellular carcinoma.
22957090 2012 Secreted protein acidic and rich in cysteine (SPARC) suppresses angiogenesis by down-regulating the expression of VEGF and MMP-7 in gastric cancer.
22956186 2013 Notch signaling regulates tumor-induced angiogenesis in SPARC-overexpressed neuroblastoma.
22955913 2012 Stromal SPARC contributes to the detrimental fibrotic changes associated with myeloproliferation whereas its deficiency favors myeloid cell expansion.
22911700 2012 The epithelial-mesenchymal transition (EMT) regulatory factor SLUG (SNAI2) is a downstream target of SPARC and AKT in promoting melanoma cell invasion.
22880013 2012 Stromal expression of decorin, Semaphorin6D, SPARC, Sprouty1 and Tsukushi in developing prostate and decreased levels of decorin in prostate cancer.
22879971 2012 SPARC is a key regulator of proliferation, apoptosis and invasion in human ovarian cancer.
22851666 2013 A novel myokine, secreted protein acidic and rich in cysteine (SPARC), suppresses colon tumorigenesis via regular exercise.
22718352 2012 Autocrine control of glioma cells adhesion and migration through IRE1?-mediated cleavage of SPARC mRNA.
22687753 2012 SPARC promotes the development of erythroid progenitors.
22567126 2012 SPARC overexpression inhibits cell proliferation in neuroblastoma and is partly mediated by tumor suppressor protein PTEN and AKT.
22563191 2012 Aberrant methylation of SPARC in human hepatocellular carcinoma and its clinical implication.
22542805 2012 Blockade of SOX4 mediated DNA repair by SPARC enhances radioresponse in medulloblastoma.
22491017 2013 An individual coding polymorphism and the haplotype of the SPARC gene predict gastric cancer recurrence.
22422640 2012 SPARC/SFN interaction, suppresses type I collagen in dermal fibroblasts.
22321704 2012 Secreted protein acidic and rich in cysteine (SPARC) is associated with nasopharyngeal carcinoma metastasis and poor prognosis.
22308039 2012 Integrin ?4 regulates SPARC protein to promote invasion.
22247475 2012 Substratum stiffness and latrunculin B regulate matrix gene and protein expression in human trabecular meshwork cells.
22246794 2012 The role of SPARC protein expression in the progress of gastric cancer.
22222271 2012 Involvement of SPARC and MMP-3 in the pathogenesis of human pterygium.
22206672 2012 SPARC expression induces cell cycle arrest via STAT3 signaling pathway in medulloblastoma cells.
22145659 2011 Knockdown of secreted protein acidic and rich in cysteine (SPARC) expression diminishes radiosensitivity of glioma cells.
22136411 2012 SPARC modulates expression of extracellular matrix genes in human trabecular meshwork cells.
22114076 2012 Deletion of the SPARC acidic domain or EGF-like module reduces SPARC-induced migration and signaling through p38 MAPK/HSP27 in glioma.
22003835 2012 The impact of the ovarian microenvironment on the anti-tumor effect of SPARC on ovarian cancer.
21976959 2011 Mutational screening of VSX1, SPARC, SOD1, LOX, and TIMP3 in keratoconus.
21962567 2011 The matricellular protein SPARC supports follicular dendritic cell networking toward Th17 responses.
21922274 2012 Methylation of the APAF-1 and DAPK-1 promoter region correlates with progression of renal cell carcinoma in North Indian population.
21867537 2011 DNA methylation of SPARC and chronic low back pain.
21850018 2011 SPARC promotes cathepsin B-mediated melanoma invasiveness through a collagen I/?2?1 integrin axis.
21818290 2011 SPARC, FOXP3, CD8 and CD45 correlation with disease recurrence and long-term disease-free survival in colorectal cancer.
21801304 2012 In vitro analyses of the anti-fibrotic effect of SPARC silencing in human Tenon's fibroblasts: comparisons with mitomycin C.
21798346 2011 SPARC mediates Src-induced disruption of actin cytoskeleton via inactivation of small GTPases Rho-Rac-Cdc42.
21778250 2011 Elevated plasma levels of SPARC in patients with newly diagnosed type 2 diabetes mellitus.
21725199 2011 Lymphovascular invasion of colorectal cancer is correlated to SPARC expression in the tumor stromal microenvironment.
21685937 2011 SPARC functions as an anti-stress factor by inactivating p53 through Akt-mediated MDM2 phosphorylation to promote melanoma cell survival.
21672357 2011 The association between circulating secreted protein acidic and rich in cysteine (SPARC) and glycosylated haemoglobin (HbA(1c)) during lifestyle-modified weight reduction intervention in obese male subjects.
21339733 2011 TP53INP1 decreases pancreatic cancer cell migration by regulating SPARC expression.
21308731 2011 Identification of a sequence in the matricellular protein SPARC that interacts with the scavenger receptor stabilin-1.
21264231 2011 SPARC is expressed in scars of the Tenon's capsule and mediates scarring properties of human Tenon's fibroblasts in vitro.
21192846 2011 Expressions of the ?2 chain of laminin-5 and secreted protein acidic and rich in cysteine in esophageal squamous cell carcinoma and their relation to prognosis.
21173124 2011 The stromal cell marker SPARC predicts for survival in patients with diffuse large B-cell lymphoma treated with rituximab.
21152079 2010 Prognostic biomarkers for esophageal adenocarcinoma identified by analysis of tumor transcriptome.
21098700 2010 Persistent activation of the Fyn/ERK kinase signaling axis mediates imatinib resistance in chronic myelogenous leukemia cells through upregulation of intracellular SPARC.
21042566 2010 Evaluation of SPARC as a candidate gene of juvenile-onset primary open-angle glaucoma by mutation and copy number analyses.
20955243 2011 The p53/p21Cip1/?Waf1 pathway mediates the effects of SPARC on melanoma cell cycle progression.
20929508 2009 Relevance of insulin-like growth factor 2 in the etiopathophysiology of diabetic nephropathy: possible roles of phosphatase and tensin homolog on chromosome 10 and secreted protein acidic and rich in cysteine as regulators of repair.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20607658 2010 Human retinal pigment epithelial SPARC expression and age: an immunohistochemical study.
20606036 2010 Identification of differentially methylated genes in normal prostate tissues from African American and Caucasian men.
20574156 2010 Stromal CD10 and SPARC expression in ductal carcinoma in situ (DCIS) patients predicts disease recurrence.
20565704 2010 Relationship and prognostic significance of SPARC and VEGF protein expression in colon cancer.
20525171 2010 Downregulation of SPARC expression decreases gastric cancer cellular invasion and survival.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20393008 2010 SPARC mRNA expression as a prognostic marker for pancreatic adenocarcinoma patients.
20369286 2011 Prognostic value of NDRG1 and SPARC protein expression in breast cancer patients.
20339379 2010 Cathepsin B facilitates autophagy-mediated apoptosis in SPARC overexpressed primitive neuroectodermal tumor cells.
20338068 2010 Methylation of the SPARC gene promoter and its clinical implication in pancreatic cancer.
20210803 SPARC (osteonectin) in breast tumors of different histologic types and its role in the outcome of invasive ductal carcinoma.
20195270 2010 SPARC: a key player in the pathologies associated with obesity and diabetes.
20132490 2010 Secreted protein, acidic and rich in cysteine (SPARC) expression in astrocytic tumour cells negatively correlates with proliferation, while vascular SPARC expression is associated with patient survival.
20087345 2010 The role of MMP-9 in the anti-angiogenic effect of secreted protein acidic and rich in cysteine.
20070483 2010 Expression of osteonectin/secreted protein acidic and rich in cysteine and matrix metalloproteinases in ameloblastoma.
20061390 2010 SPARC suppresses apoptosis of idiopathic pulmonary fibrosis fibroblasts through constitutive activation of beta-catenin.
19920824 2010 Inhibition of endogenous SPARC enhances pancreatic cancer cell growth: modulation by FGFR1-III isoform expression.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19900269 2009 Insights in to the pathogenesis of axial spondyloarthropathy based on gene expression profiles.
19830689 2010 Overexpression of SPARC obliterates the in vivo tumorigenicity of human hepatocellular carcinoma cells.
19817957 2009 Secreted protein acidic and rich in cysteine (SPARC) gene polymorphism association with hepatocellular carcinoma in Italian patients.
19780053 2010 Gene expression analysis identifies over-expression of CXCL1, SPARC, SPP1, and SULF1 in gastric cancer.
19703125 2009 Immunohistochemical expression of SPARC is correlated with recurrence, survival and malignant potential in meningiomas.
19700761 2009 Bone marrow-derived cathepsin K cleaves SPARC in bone metastasis.
19661316 2009 SPARC is expressed in human uveal melanoma and its abrogation reduces tumor cell proliferation.
19597474 2009 The role of SPARC in the TRAMP model of prostate carcinogenesis and progression.
19509023 2009 Regulation of the fibrosis and angiogenesis promoter SPARC/osteonectin in human adipose tissue by weight change, leptin, insulin, and glucose.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19448421 2009 Expression and clinical significance of SPARC in clinical stage II tongue squamous cell carcinoma.
19403984 2009 SPARC is a major secretory gene expressed and involved in the development of proliferative diabetic retinopathy.
19236378 2010 Reduced activity of CD13/aminopeptidase N (APN) in aggressive meningiomas is associated with increased levels of SPARC.
19177197 2009 Aberrant promoter methylation of SPARC in ovarian cancer.
18949063 2008 Increased SPARC expression in primary angle closure glaucoma iris.
18813945 2008 CD34(+) fibrocytes in melanocytic nevi and malignant melanomas of the skin.
18813349 2008 SPARC ameliorates ovarian cancer-associated inflammation.
18808384 2008 Identification of a novel protein promoting the colonization and survival of Finegoldia magna, a bacterial commensal and opportunistic pathogen.
18796407 2009 Secreted protein acidic and rich in cysteine (SPARC) in human skeletal muscle.
18787407 2008 Stromal SPARC expression and patient survival after chemoradiation for non-resectable pancreatic adenocarcinoma.
18583538 2008 IFATS collection: Combinatorial peptides identify alpha5beta1 integrin as a receptor for the matricellular protein SPARC on adipose stromal cells.
18487610 2008 Mapping of SPARC/BM-40/osteonectin-binding sites on fibrillar collagens.
18442089 2008 HSP27 mediates SPARC-induced changes in glioma morphology, migration, and invasion.
18442048 2008 Sparc localizes to the blebs of hobit cells and human primary osteoblasts.
18410576 2008 Secreted protein acidic, rich in cysteine induces pulp cell migration via alphavbeta3 integrin and extracellular signal-regulated kinase.
18367635 2008 The nonsteroidal anti-inflammatory drug NS398 reactivates SPARC expression via promoter demethylation to attenuate invasiveness of lung cancer cells.
18350569 2008 SPARC-induced increase in glioma matrix and decrease in vascularity are associated with reduced VEGF expression and secretion.
18253934 2008 A prototypic matricellular protein in the tumor microenvironment--where there's SPARC, there's fire.
18084690 2008 Osteonectin/SPARC polymorphisms in Caucasian men with idiopathic osteoporosis.
18059024 2008 SPARC modulates the proliferation of stromal but not melanoma cells unless endogenous SPARC expression is downregulated.
17994631 2007 Proteomic analysis identified N-cadherin, clusterin, and HSP27 as mediators of SPARC (secreted protein, acidic and rich in cysteines) activity in melanoma cells.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17970686 2007 SPARC gene polymorphism in renal transplant patients with gingival overgrowth.
17724718 2007 Osteonectin downregulates E-cadherin, induces osteopontin and focal adhesion kinase activity stimulating an invasive melanoma phenotype.
17681430 2008 Nasopharyngeal angiofibroma with intracellular accumulation of SPARC - a hypothesis (SPARC in nasopharyngeal angiofibroma).
17638862 2007 A secreted isoform of ErbB3 promotes osteonectin expression in bone and enhances the invasiveness of prostate cancer cells.
17625595 2007 SPARC endogenous level, rather than fibroblast-produced SPARC or stroma reorganization induced by SPARC, is responsible for melanoma cell growth.
17586526 2007 The motif of SPARC that inhibits DNA synthesis is not a nuclear localization signal.
17490812 2007 SPARC upregulates MT1-MMP expression, MMP-2 activation, and the secretion and cleavage of galectin-3 in U87MG glioma cells.
17487382 2007 Overexpression of SPARC protein contrasts with its transcriptional silencing by aberrant hypermethylation of SPARC CpG-rich region in endometrial carcinoma.
17435158 2007 Salivary biomarkers associated with alveolar bone loss.
17397030 2007 Frequent inactivation of SPARC by promoter hypermethylation in colon cancers.
17343824 2007 SATB1 regulates SPARC expression in K562 cell line through binding to a specific sequence in the third intron.
17235047 2007 Peritumoral fibroblast SPARC expression and patient outcome with resectable pancreatic adenocarcinoma.
17213807 2007 Targeting SPARC expression decreases glioma cellular survival and invasion associated with reduced activities of FAK and ILK kinases.
17022822 2006 Effects of THBS3, SPARC and SPP1 expression on biological behavior and survival in patients with osteosarcoma.
16972886 2006 Patterns of SPARC expression and basement membrane intactness at the tumour-brain border of invasive meningiomas.
16735494 2006 Differential zonal expression and adrenocorticotropin regulation of secreted protein acidic and rich in cysteine (SPARC), a matricellular protein, in the midgestation human fetal adrenal gland: implications for adrenal development.
16670288 2006 Novel function of alternatively activated macrophages: stabilin-1-mediated clearance of SPARC.
16299239 2005 Highly sensitive detection of melanoma at an early stage based on the increased serum secreted protein acidic and rich in cysteine and glypican-3 levels.
16263253 2006 Secreted protein acidic and rich in cysteine (SPARC/osteonectin/BM-40) binds to fibrinogen fragments D and E, but not to native fibrinogen.
16173048 2006 Roles of osteonectin in the migration of breast cancer cells into bone.
16121393 2006 The C-terminal Ca2+-binding domain of SPARC confers anti-spreading activity to human urothelial cells.
16012759 2005 Expression of SPARC in tongue carcinoma of stage II is associated with poor prognosis: an immunohistochemical study of 86 cases.
15838642 2005 Stromal remodeling and SPARC (secreted protein acid rich in cysteine) expression in invasive ductal carcinomas of the breast.
15795937 2005 Enhanced angiogenesis characteristic of SPARC-null mice disappears with age.
15763439 2005 Gamma-Linolenic acid regulates the expression and secretion of SPARC in human cancer cells.
15763438 2005 Increased levels of SPARC (osteonectin) in human breast cancer tissues and its association with clinical outcomes.
15641096 2005 Small interfering RNA inhibition of SPARC attenuates the profibrotic effect of transforming growth factor beta1 in cultured normal human fibroblasts.
15609325 2005 Identification and validation of novel ERBB2 (HER2, NEU) targets including genes involved in angiogenesis.
15558074 2004 Overexpression of SPARC gene in human gastric carcinoma and its clinic-pathologic significance.
15546965 2005 Single-nucleotide polymorphisms in the SPARC gene are not associated with susceptibility to scleroderma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15480132 2004 Cellular, but not matrix, immunolocalization of SPARC in the human intervertebral disc: decreasing localization with aging and disc degeneration.
15469933 2004 Secreted protein acidic, rich in cysteine (SPARC), mediates cellular survival of gliomas through AKT activation.
15389586 2005 Spreading of embryologically distinct urothelial cells is inhibited by SPARC.
15246191 2004 Increased osteonectin expression is associated with malignant transformation and tumor associated fibrosis in the lung.
15034927 2004 SPARC regulates TGF-beta1-dependent signaling in primary glomerular mesangial cells.
15014008 2004 Osteopontin but not osteonectin messenger RNA expression is a prognostic marker in curatively resected non-small cell lung cancer.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14500371 2003 Enhanced expression of SPARC/osteonectin in the tumor-associated stroma of non-small cell lung cancer is correlated with markers of hypoxia/acidity and with poor prognosis of patients.
12879219 2003 Gene polymorphisms, bone mineral density and bone mineral content in young children: the Iowa Bone Development Study.
12867428 2003 Cleavage of the matricellular protein SPARC by matrix metalloproteinase 3 produces polypeptides that influence angiogenesis.
12721366 2003 SPARC-null mice exhibit increased adiposity without significant differences in overall body weight.
12658547 2002 The role of matricellular proteins thrombospondin-1 and osteonectin during RPE cell migration in proliferative vitreoretinopathy.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12428242 2002 Association of novel polymorphisms with the expression of SPARC in normal fibroblasts and with susceptibility to scleroderma.
12427131 2002 Localization of SPARC in developing, mature, and chronically injured human allograft kidneys.
12402984 2002 Quantitative analysis of osteonectin mRNA in thyroid carcinomas.
12370830 2002 Transcriptional upregulation of SPARC, in response to c-Jun overexpression, contributes to increased motility and invasion of MCF7 breast cancer cells.
12201246 2002 SPARC stimulates the synthesis of OPG/OCIF, MMP-2 and DNA in human periodontal ligament cells.
12169206 MYCL1, FHIT, SPARC, p16(INK4) and TP53 genes associated to lung cancer in idiopathic pulmonary fibrosis.
11956183 2002 The type XIII collagen ectodomain is a 150-nm rod and capable of binding to fibronectin, nidogen-2, perlecan, and heparin.
11856645 2002 Investigation of osteocalcin, osteonectin, and dentin sialophosphoprotein in developing human teeth.
11554745 2001 Induction of SPARC by VEGF in human vascular endothelial cells.
11445660 2001 The expression of SPARC in adipose tissue and its increased plasma concentration in patients with coronary artery disease.
10937551 2000 Osteonectin/SPARC secreted by RPE and localized to the outer plexiform layer of the monkey retina.
10880278 2000 Expression and characterization of SPARC in human lens and in the aqueous and vitreous humors.
10801822 2000 Calcium affinity, cooperativity, and domain interactions of extracellular EF-hands present in BM-40.
10756178 2000 Increased expression of osteonectin/SPARC mRNA and protein in age-related human cataracts and spatial expression in the normal human lens.
10567433 1999 SPARC, a matricellular glycoprotein with important biological functions.
9792673 1998 SPARC (BM-40, osteonectin) inhibits the mitogenic effect of vascular endothelial growth factor on microvascular endothelial cells.
9501084 1998 Crystal structure and mapping by site-directed mutagenesis of the collagen-binding epitope of an activated form of BM-40/SPARC/osteonectin.
9457905 1998 BM-40 (osteonectin, SPARC) is expressed both in the epidermal and in the dermal compartment of adult human skin.
9284812 1997 Osteonectin (SPARC) expression in human liver and in cultured human liver myofibroblasts.
9233787 1997 Crystal structure of a pair of follistatin-like and EF-hand calcium-binding domains in BM-40.
8826089 1995 Matrix proteins associated with bone calcification are present in human vascular smooth muscle cells grown in vitro.
8647860 1996 Proteolytic activity of human osteoclast cathepsin K. Expression, purification, activation, and substrate identification.
8626499 1996 Elements within the first 17 amino acids of human osteonectin are responsible for binding to type V collagen.
8548457 1996 Structure of a novel extracellular Ca(2+)-binding module in BM-40.
8516290 1993 Cytogenetic and molecular delineation of the smallest commonly deleted region of chromosome 5 in malignant myeloid diseases.
7982919 1994 Osteonectin in matrix remodeling. A plasminogen-osteonectin-collagen complex.
7875683 1995 Expression of SPARC in normal and fibrotic livers.
7829101 1994 Isolation of novel and known genes from a human fetal cochlear cDNA library using subtractive hybridization and differential screening.
7821789 1994 Construction of a human full-length cDNA bank.
7730416 1995 Transglutaminase-catalyzed matrix cross-linking in differentiating cartilage: identification of osteonectin as a major glutaminyl substrate.
7721952 1995 Inhibition of endothelial cell proliferation by SPARC is mediated through a Ca(2+)-binding EF-hand sequence.
7563094 1995 The C-terminal portion of BM-40 (SPARC/osteonectin) is an autonomously folding and crystallisable domain that binds calcium and collagen IV.
7559469 1995 Role of N-linked glycosylation in human osteonectin. Effect of carbohydrate removal by N-glycanase and site-directed mutagenesis on structure and binding of type V collagen.
7495300 1995 Immunolocalization of SPARC, tenascin, and thrombospondin in pulmonary fibrosis.
7034958 1981 Osteonectin, a bone-specific protein linking mineral to collagen.
6368555 1984 Characterization of a novel serum albumin-binding glycoprotein secreted by endothelial cells in culture.
3597437 1987 Purification and partial characterization of small proteoglycans I and II, bone sialoproteins I and II, and osteonectin from the mineral compartment of developing human bone.
3581152 1987 Osteonectin--a differentiation marker of bone cells.
3489235 1986 Human platelets contain and secrete osteonectin, a major protein of mineralized bone.
3410046 1988 Cloning and complete amino acid sequences of human and murine basement membrane protein BM-40 (SPARC, osteonectin).
3402455 1988 Complex formation of human thrombospondin with osteonectin.
3400777 1988 Osteonectin/SPARC/BM-40 in human decidua and carcinoma, tissues characterized by de novo formation of basement membrane.
2838412 1988 Molecular analysis of the cDNA for human SPARC/osteonectin/BM-40: sequence, expression, and localization of the gene to chromosome 5q31-q33.
2790009 1989 Structure of human osteonectin based upon analysis of cDNA and genomic sequences.
2745554 1989 SPARC, a secreted protein associated with cellular proliferation, inhibits cell spreading in vitro and exhibits Ca+2-dependent binding to the extracellular matrix.
2505905 1989 Localization of osteonectin expression in human fetal skeletal tissues by in situ hybridization.
2338025 1990 Structure and expression of osteonectin mRNA in human tissue.
2306517 1990 Human platelet osteonectin: release, surface expression, and partial characterization.
1737102 1992 Localization of platelet osteonectin at the internal face of the alpha-granule membranes in platelets and megakaryocytes.
1552170 1992 Distribution of osteonectin mRNA and protein during human embryonic and fetal development.
1311092 1992 The extracellular glycoprotein SPARC interacts with platelet-derived growth factor (PDGF)-AB and -BB and inhibits the binding of PDGF to its receptors.
1093755 1975 Pharmacological effects of alpha-methyldopa, alpha-methylnorepinephrine, and octopamine on rat arteriolar, arterial, and terminal vascular smooth.