Property Summary

NCBI Gene PubMed Count 16
PubMed Score 92.46
PubTator Score 18.94

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
24055112 SPAG1 probably plays a role in the cytoplasmic assembly.
16983343 Immunocytochemical analysis demonstrated colocalization of SPAG1 with microtubules, and their association was confirmed by co-immunoprecipitation; subsequent motility assays further substantiated a potential role of SPAG1 in cancer cell motility
16368546 HSD-3.8 (SPAG1), interacts with G-protein beta 1 subunit and activates extracellular signal-regulated kinases 1 and 2
12846798 The h-Sp-1 molecule is expressed in sperm and testes and plays a role in fertilization.

AA Sequence

MTTKDYPSLWGFGTTKTFKIPIEHLDFKYIEKCSDVKHLEKILCVLRSGEEGYYPELTEFCEKHLQALAP      1 - 70
ESRALRKDKPAATAASFTAEEWEKIDGDIKSWVSEIKKEEDKMHFHETETFPAMKDNLPPVRGSNSCLHV     71 - 140
GKEKYSKRPTKKKTPRDYAEWDKFDVEKECLKIDEDYKEKTVIDKSHLSKIETRIDTAGLTEKEKDFLAT    141 - 210
REKEKGNEAFNSGDYEEAVMYYTRSISALPTVVAYNNRAQAEIKLQNWNSAFQDCEKVLELEPGNVKALL    211 - 280
RRATTYKHQNKLREATEDLSKVLDVEPDNDLAKKTLSEVERDLKNSEAASETQTKGKRMVIQEIENSEDE    281 - 350
EGKSGRKHEDGGGDKKPAEPAGAARAAQPCVMGNIQKKLTGKAEGGKRPARGAPQRGQTPEAGADKRSPR    351 - 420
RASAAAAAGGGATGHPGGGQGAENPAGLKSQGNELFRSGQFAEAAGKYSAAIALLEPAGSEIADDLSILY    421 - 490
SNRAACYLKEGNCSGCIQDCNRALELHPFSMKPLLRRAMAYETLEQYGKAYVDYKTVLQIDCGLQLANDS    491 - 560
VNRLSRILMELDGPNWREKLSPIPAVPASVPLQAWHPAKEMISKQAGDSSSHRQQGITDEKTFKALKEEG    561 - 630
NQCVNDKNYKDALSKYSECLKINNKECAIYTNRALCYLKLCQFEEAKQDCDQALQLADGNVKAFYRRALA    631 - 700
HKGLKNYQKSLIDLNKVILLDPSIIEAKMELEEVTRLLNLKDKTAPFNKEKERRKIEIQEVNEGKEEPGR    701 - 770
PAGEVSMGCLASEKGGKSSRSPEDPEKLPIAKPNNAYEFGQIINALSTRKDKEACAHLLAITAPKDLPMF    771 - 840
LSNKLEGDTFLLLIQSLKNNLIEKDPSLVYQHLLYLSKAERFKMMLTLISKGQKELIEQLFEDLSDTPNN    841 - 910
HFTLEDIQALKRQYEL                                                          911 - 926
//

Text Mined References (18)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24055112 2013 Mutations in SPAG1 cause primary ciliary dyskinesia associated with defective outer and inner dynein arms.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16983343 2007 Sperm-associated antigen 1 is expressed early in pancreatic tumorigenesis and promotes motility of cancer cells.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16368546 2006 A sperm component, HSD-3.8 (SPAG1), interacts with G-protein beta 1 subunit and activates extracellular signal-regulated kinases (ERK).
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12846798 2003 Isolation and characterization of a human sperm antigen gene h-Sp-1.
12509440 2003 Phosphoproteome analysis of capacitated human sperm. Evidence of tyrosine phosphorylation of a kinase-anchoring protein 3 and valosin-containing protein/p97 during capacitation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11517287 2001 Expression and function of the HSD-3.8 gene encoding a testis-specific protein.
10527845 1999 A tetratricopeptide repeat-containing protein gene, tpis, whose expression is induced with differentiation of spermatogenic cells.
9138444 1997 Sperm antigens and their use in the development of an immunocontraceptive.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8849440 1996 A gene map of the human genome.
1299558 1992 Isolation and sequencing of the cDNA encoding the 75-kD human sperm protein related to infertility.