Property Summary

NCBI Gene PubMed Count 19
PubMed Score 21.25
PubTator Score 17.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma 2.600 1.8e-02
oligodendroglioma 3.100 5.6e-03
posterior fossa group A ependymoma -2.100 9.6e-05
group 3 medulloblastoma -3.200 2.0e-04
atypical teratoid/rhabdoid tumor -1.600 1.9e-03
medulloblastoma, large-cell -3.400 8.9e-05
breast carcinoma -1.400 4.4e-03
pilocytic astrocytoma 2.200 6.8e-08
subependymal giant cell astrocytoma -3.138 9.2e-03
invasive ductal carcinoma -1.294 8.9e-03
psoriasis -1.800 1.9e-10
non-inflammatory breast cancer -1.900 2.9e-05
Pick disease -1.100 2.8e-02

Gene RIF (7)

PMID Text
25550787 In non-small cell lung cancer, SOX8 expression was elevated, and correlated with tumor size, lymph node metastasis, clinical stage and differentiation classification.
25400731 Suggest that miRNA-124 may regulate non-small cell lung carcinoma cell proliferation via decreasing SOX8.
24643625 SOX8 promotes cancer cell proliferation and its expression is correlated with elevated beta-catenin levels in hepatocellular carcinoma
24449344 SOX8 mRNA levels decrease during in vitro dedifferentiation of human articular chondrocytes and increase during chondrogenic differentiation of mesenchymal stromal cells.
23739915 The SOX8 single nucleotide polymorphism, rs2744148, is associated with increased genetic risk for multiple sclerosis.
19369635 SOX2 and SOX17 expression patterns can distinguish between seminoma and embryonal carcinoma, and this distinction may be diagnostically useful.
18512230 Quantitative changes of enteric glia represented by SOX8 provide a basis for pathological assessment of glial proliferation and/or degeneration in the diseased gut.

AA Sequence

MLDMSEARSQPPCSPSGTASSMSHVEDSDSDAPPSPAGSEGLGRAGVAVGGARGDPAEAADERFPACIRD      1 - 70
AVSQVLKGYDWSLVPMPVRGGGGGALKAKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLW     71 - 140
RLLSESEKRPFVEEAERLRVQHKKDHPDYKYQPRRRKSAKAGHSDSDSGAELGPHPGGGAVYKAEAGLGD    141 - 210
GHHHGDHTGQTHGPPTPPTTPKTELQQAGAKPELKLEGRRPVDSGRQNIDFSNVDISELSSEVMGTMDAF    211 - 280
DVHEFDQYLPLGGPAPPEPGQAYGGAYFHAGASPVWAHKSAPSASASPTETGPPRPHIKTEQPSPGHYGD    281 - 350
QPRGSPDYGSCSGQSSATPAAPAGPFAGSQGDYGDLQASSYYGAYPGYAPGLYQYPCFHSPRRPYASPLL    351 - 420
NGLALPPAHSPTSHWDQPVYTTLTRP                                                421 - 446
//

Text Mined References (19)

PMID Year Title
25550787 2014 miRNA-124 down-regulates SOX8 expression and suppresses cell proliferation in non-small cell lung cancer.
25400731 2014 miRNA-124 down-regulates SOX8 expression and suppresses cell proliferation in non-small cell lung cancer.
24643625 2014 Oncogenicity of the transcription factor SOX8 in hepatocellular carcinoma.
24449344 2014 Brief report: importance of SOX8 for in vitro chondrogenic differentiation of human mesenchymal stromal cells.
23739915 2013 MANBA, CXCR5, SOX8, RPS6KB1 and ZBTB46 are genetic risk loci for multiple sclerosis.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
19369635 2009 Differential expression of SOX2 and SOX17 in testicular germ cell tumors.
18512230 2008 Quantitative assessment of glial cells in the human and guinea pig enteric nervous system with an anti-Sox8/9/10 antibody.
16582099 2006 The high-mobility-group domain of Sox proteins interacts with DNA-binding domains of many transcription factors.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12732652 2003 SOX8 is expressed during testis differentiation in mice and synergizes with SF1 to activate the Amh promoter in vitro.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11483257 2001 Sox8 gene expression identifies immature glial cells in developing cerebellum and cerebellar tumours.
11157797 2001 Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16.
10684944 2000 Cloning and characterisation of the Sry-related transcription factor gene Sox8.
10662550 2000 The SOX8 gene is located within 700 kb of the tip of chromosome 16p and is deleted in a patient with ATR-16 syndrome.