Property Summary

NCBI Gene PubMed Count 56
PubMed Score 110.32
PubTator Score 60.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
astrocytic glioma 1.800 1.6e-03
ependymoma 1.400 4.9e-02
oligodendroglioma 2.000 4.0e-03
osteosarcoma -2.225 2.4e-02
glioblastoma 1.700 1.4e-04
periodontitis -1.200 1.7e-18
medulloblastoma -1.600 4.0e-02
medulloblastoma, large-cell 1.800 1.4e-03
intraductal papillary-mucinous carcinoma... -1.900 6.2e-03
intraductal papillary-mucinous neoplasm ... -2.300 5.3e-03
pediatric high grade glioma 1.300 1.5e-02
pilocytic astrocytoma 2.600 1.2e-07
psoriasis -1.300 7.9e-26
subependymal giant cell astrocytoma 1.698 7.3e-03
nasopharyngeal carcinoma 1.800 1.1e-03
Breast cancer -1.400 2.4e-03
mucosa-associated lymphoid tissue lympho... 1.317 4.9e-02
ductal carcinoma in situ -1.700 2.7e-03
invasive ductal carcinoma -2.200 2.3e-04
ovarian cancer -3.300 3.3e-08
pituitary cancer 1.400 1.9e-04

 GO Component (2)

Protein-protein Interaction (1)

Gene RIF (28)

PMID Text
26893351 SOX6 is a novel regulator of adipogenesis synergizing with epigenetic mechanisms.
26119940 The highly conserved high-mobility group (HMG) domain of SOX6 is required for SOX6-mediated p53 stabilization and tumor inhibitory activity.
25457384 SCF-mediated gamma-globin gene expression in adult human erythroid cells is associated with KLF1, BCL11A and SOX6 down-regulation.
25023649 results suggest that miR-208 represents a potential onco-miR and participates in ESCC carcinogenesis by suppressing SOX6 expression
23731550 Findings provide evidence for the first time that SOX6 expression was decreased in hepatocellular carcinoma.
22547066 L-Sox5 and Sox6 proteins enhance chondrogenic miR-140 microRNA expression by strengthening dimeric Sox9 activity
21728837 SOX trio gene and protein decreased with advancement of osteoarthritis in human articular cartilage.
21625884 Genetic variants in the SOX6 gene are associated with bone mineral density in both Caucasian and Chinese populations
21263153 Sox6 enhances erythroid differentiation in human erythroid progenitors.
21262861 identified SOX5 and SOX6 as the first two SHOX-interacting proteins and have shown that this interaction regulates aggrecan expression, an essential factor in chondrogenesis and skeletal development.
21104366 Results support the SOX6 gene as an important gene for bone mineral density variation.
21084391 The SOX6 is a novel tumor-suppressor gene in ESCC development and is a potential prognostic marker in esophageal squamous cell carcinoma.
20966410 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20548944 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20395365 transcriptional silencing of gamma-globin genes by BCL11A involves long-range interactions and cooperation with SOX6
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19714249 SOX6 was previously found to be essential to both cartilage formation/chondrogenesis and obesity-related insulin resistance, suggesting the gene's dual role in both bone and fat
19714249 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19709629 Although Sox6 is not required for specification of medial ganglionic eminence (MGE)-derived cortical interneurons, Sox6 gene is necessary for the normal positioning and maturation of these cells.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19384854 Results suggest that DAX-1 and SOX6 proteins interact, have overlapped expression in the testis, and act antagonistically during pre-mRNA splicing.
19240061 Observational study of gene-disease association. (HuGE Navigator)
17433257 Thus, we successfully identified the Sox6 promoter and its core enhancer and characterized the interactions with regulatory transcription factors.
16442531 co-expression of SOX6 with SUMO2 results in the appearance of SOX6 in a punctate nuclear pattern that colocalized with promyelocytic leukemia protein, which was partially abolished by mutations in SOX6 sumoylation sites
15696972 SOX6 may be a useful marker for the diagnosis of tumors arising from immature bipotential cells that may differentiate into neuronal and glial cells.
15696967 SOX6 may be a potential diagnostic marker for gliomas.

AA Sequence

MSSKQATSPFACAADGEDAMTQDLTSREKEEGSDQHVASHLPLHPIMHNKPHSEELPTLVSTIQQDADWD      1 - 70
SVLSSQQRMESENNKLCSLYSFRNTSTSPHKPDEGSRDREIMTSVTFGTPERRKGSLADVVDTLKQKKLE     71 - 140
EMTRTEQEDSSCMEKLLSKDWKEKMERLNTSELLGEIKGTPESLAEKERQLSTMITQLISLREQLLAAHD    141 - 210
EQKKLAASQIEKQRQQMDLARQQQEQIARQQQQLLQQQHKINLLQQQIQVQGHMPPLMIPIFPHDQRTLA    211 - 280
AAAAAQQGFLFPPGITYKPGDNYPVQFIPSTMAAAAASGLSPLQLQKGHVSHPQINQRLKGLSDRFGRNL    281 - 350
DTFEHGGGHSYNHKQIEQLYAAQLASMQVSPGAKMPSTPQPPNTAGTVSPTGIKNEKRGTSPVTQVKDEA    351 - 420
AAQPLNLSSRPKTAEPVKSPTSPTQNLFPASKTSPVNLPNKSSIPSPIGGSLGRGSSLDILSSLNSPALF    421 - 490
GDQDTVMKAIQEARKMREQIQREQQQQQPHGVDGKLSSINNMGLNSCRNEKERTRFENLGPQLTGKSNED    491 - 560
GKLGPGVIDLTRPEDAEGSKAMNGSAAKLQQYYCWPTGGATVAEARVYRDARGRASSEPHIKRPMNAFMV    561 - 630
WAKDERRKILQAFPDMHNSNISKILGSRWKSMSNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPKRTCIV    631 - 700
DGKKLRIGEYKQLMRSRRQEMRQFFTVGQQPQIPITTGTGVVYPGAITMATTTPSPQMTSDCSSTSASPE    701 - 770
PSLPVIQSTYGMKTDGGSLAGNEMINGEDEMEMYDDYEDDPKSDYSSENEAPEAVSAN                771 - 828
//

Text Mined References (61)

PMID Year Title
26893351 2016 The transcription factor SOX6 contributes to the developmental origins of obesity by promoting adipogenesis.
26119940 2016 Role of p14ARF-HDM2-p53 axis in SOX6-mediated tumor suppression.
25457384 2015 SCF-mediated ?-globin gene expression in adult human erythroid cells is associated with KLF1, BCL11A and SOX6 down-regulation.
25293881 2015 The contribution of common genetic variation to nicotine and cotinine glucuronidation in multiple ethnic/racial populations.
25249183 2015 Genome-wide association study in Chinese identifies novel loci for blood pressure and hypertension.
25199915 2015 GWAS of longevity in CHARGE consortium confirms APOE and FOXO3 candidacy.
25023649 2014 Mir-208 promotes cell proliferation by repressing SOX6 expression in human esophageal squamous cell carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24249740 2014 Multistage genome-wide association meta-analyses identified two new loci for bone mineral density.
23972371 2013 Genome-wide association analysis of blood-pressure traits in African-ancestry individuals reveals common associated genes in African and non-African populations.
23731550 2013 Decreased expression of SOX6 confers a poor prognosis in hepatocellular carcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22864933 2012 Identification of novel germline polymorphisms governing capecitabine sensitivity.
22547066 2012 L-Sox5 and Sox6 proteins enhance chondrogenic miR-140 microRNA expression by strengthening dimeric Sox9 activity.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
21728837 2011 SOX trio decrease in the articular cartilage with the advancement of osteoarthritis.
21625884 2012 Genetic variants in the SOX6 gene are associated with bone mineral density in both Caucasian and Chinese populations.
21401405 2011 Electroporation-mediated transfer of SOX trio genes (SOX-5, SOX-6, and SOX-9) to enhance the chondrogenesis of mesenchymal stem cells.
21263153 2011 Sox6 enhances erythroid differentiation in human erythroid progenitors.
21262861 2011 SHOX interacts with the chondrogenic transcription factors SOX5 and SOX6 to activate the aggrecan enhancer.
21104366 2010 A genome-wide association analysis implicates SOX6 as a candidate gene for wrist bone mass.
21084391 2011 Characterization of tumor-suppressive function of SOX6 in human esophageal squamous cell carcinoma.
20966410 2010 Genomewide linkage and peakwide association analyses of carotid plaque in Caribbean Hispanics.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20548944 2010 An integration of genome-wide association study and gene expression profiling to prioritize the discovery of novel susceptibility Loci for osteoporosis-related traits.
20395365 2010 Transcriptional silencing of {gamma}-globin by BCL11A involves long-range interactions and cooperation with SOX6.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20081117 2010 MicroRNA-1 and -499 regulate differentiation and proliferation in human-derived cardiomyocyte progenitor cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19801982 2009 Twenty bone-mineral-density loci identified by large-scale meta-analysis of genome-wide association studies.
19714249 2009 Powerful bivariate genome-wide association analyses suggest the SOX6 gene influencing both obesity and osteoporosis phenotypes in males.
19709629 2009 The cell-intrinsic requirement of Sox6 for cortical interneuron development.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19384854 2009 DAX-1 and SOX6 molecular interplay results in an antagonistic effect in pre-mRNA splicing.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
17961134 2007 Expression of SoxE and SoxD genes in human gliomas.
17433257 2007 Identification and characterization of the human SOX6 promoter.
17412698 2007 SOX6 suppresses cyclin D1 promoter activity by interacting with beta-catenin and histone deacetylase 1, and its down-regulation induces pancreatic beta-cell proliferation.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16442531 2006 Repression of SOX6 transcriptional activity by SUMO modification.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16258006 2006 Balanced translocation in a patient with craniosynostosis disrupts the SOX6 gene and an evolutionarily conserved non-transcribed region.
15696972 2004 Immunohistochemical analysis of SOX6 expression in human brain tumors.
15696967 2004 Expression of a transcriptional factor, SOX6, in human gliomas.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14691456 2004 Identification of a human glioma antigen, SOX6, recognized by patients' sera.
14530442 2003 Sox6 regulation of cardiac myocyte development.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11504872 2001 SOX6 binds CtBP2 to repress transcription from the Fgf-3 promoter.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11255018 2001 Cloning, characterization and chromosome mapping of the human SOX6 gene.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10996314 2000 Characterization of Solt, a novel SoxLZ/Sox6 binding protein expressed in adult mouse testis.
10760285 2000 Sox6 is a candidate gene for p100H myopathy, heart block, and sudden neonatal death.
9755172 1998 A new long form of Sox5 (L-Sox5), Sox6 and Sox9 are coexpressed in chondrogenesis and cooperatively activate the type II collagen gene.
1614875 1992 A conserved family of genes related to the testis determining gene, SRY.