Property Summary

NCBI Gene PubMed Count 21
PubMed Score 165.15
PubTator Score 17.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
nephrosclerosis 1.171 3.5e-03
astrocytic glioma -1.900 1.0e-02
ependymoma -2.000 1.8e-02
oligodendroglioma -1.900 1.4e-02
glioblastoma -2.000 1.6e-06
medulloblastoma, large-cell -1.700 9.4e-04
Crohn's disease -1.064 2.8e-03
ulcerative colitis -1.243 1.0e-02
non-small cell lung carcinoma -2.300 1.2e-20
intraductal papillary-mucinous adenoma (... 4.100 1.0e-04
colon cancer -1.800 4.2e-03
interstitial cystitis -3.600 6.8e-05
lung adenocarcinoma -3.100 3.2e-20
pediatric high grade glioma -1.400 3.1e-05
atypical teratoid/rhabdoid tumor 1.400 4.1e-02
group 3 medulloblastoma -1.600 6.2e-03
pilocytic astrocytoma -1.800 1.3e-07
Breast cancer -4.700 9.1e-25
lung carcinoma -2.700 1.0e-11
breast carcinoma -2.000 3.0e-20
gastric carcinoma -3.700 3.9e-02

Gene RIF (12)

PMID Text
26378658 Down-regulation of SOSTDC1 promotes thyroid cancer cell proliferation via regulating cyclin A2 and cyclin E2.
25858146 Epigenetic silencing of SOSTDC1 through methylation is increased in prostate cancer and is associated with accelerated disease progression in patients with prostate cancer
25338303 Results conclude that the transcriptional repressor E4BP4 plays a role in repressing epigenetically regulated SOSTDC1 expression in breast cancer cells, which can be reverted by E4BP4 silencing.
24190897 Unliganded VDR upregulates the expression of hairless, the gene product of which acts as a downstream comodulator to feedback-repress DKKL1 and SOSTDC1.
23830730 DNA methylation is involved in the down-regulation of SOSTDC1 expression in gastric cancer.
21221677 Results indicate for the first time that the genetic polymorphisms in SOSTDC1 have an effect on attainment and maintenance of peak bone mass in Chinese women.
21113658 SOSTDC1 is expressed in normal breast tissue and this expression is reduced in breast cancer.
21080955 genetic aberrations near SOSTDC1 are not uncommon in renal cancer, and occur in adult as well as pediatric renal tumors.
19760604 Loss of SOSTDC1 gene is associated with Wilms tumor.
18032587 This screen identified a bone morphogenetic protein (BMP) antagonist, SOSTDC1 (sclerostin domain-containing-1) as down-regulated in kidney tumors.
15020244 USAG1 is expressed in the kidney and functions as a bone morphogenetic protein antagonist.
14623234 Data suggest that ectodin is a novel bone morphogenetic protein (BMP) inhibitor which integrates BMP signaling with the SHH and FGF signal pathways

AA Sequence

MLPPAIHFYLLPLACILMKSCLAFKNDATEILYSHVVKPVPAHPSSNSTLNQARNGGRHFSNTGLDRNTR      1 - 70
VQVGCRELRSTKYISDGQCTSISPLKELVCAGECLPLPVLPNWIGGGYGTKYWSRRSSQEWRCVNDKTRT     71 - 140
QRIQLQCQDGSTRTYKITVVTACKCKRYTRQHNESSHNFESMSPAKPVQHHRERKRASKSSKHSMS        141 - 206
//

Text Mined References (23)

PMID Year Title
26378658 2015 Down-regulation of SOSTDC1 promotes thyroid cancer cell proliferation via regulating cyclin A2 and cyclin E2.
25858146 2015 Hepcidin regulation in prostate and its disruption in prostate cancer.
25338303 2014 E4BP4 is a repressor of epigenetically regulated SOSTDC1 expression in breast cancer cells.
24190897 2014 Vitamin D receptor-mediated control of Soggy, Wise, and Hairless gene expression in keratinocytes.
23830730 2013 SOSTDC1 down-regulation of expression involves CpG methylation and is a potential prognostic marker in gastric cancer.
21221677 2011 Contribution of the sclerostin domain-containing protein 1 (SOSTDC1) gene to normal variation of peak bone mineral density in Chinese women and men.
21113658 2011 SOSTDC1 differentially modulates Smad and beta-catenin activation and is down-regulated in breast cancer.
21080955 2010 Loss of heterozygosity and SOSTDC1 in adult and pediatric renal tumors.
20339536 2010 Genome-wide association of lipid-lowering response to statins in combined study populations.
19760604 2009 Two candidate tumor suppressor genes, MEOX2 and SOSTDC1, identified in a 7p21 homozygous deletion region in a Wilms tumor.
18032587 2008 A human bone morphogenetic protein antagonist is down-regulated in renal cancer.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15951218 2005 BMP antagonists: their roles in development and involvement in pathophysiology.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15280373 2004 Speriolin is a novel spermatogenic cell-specific centrosomal protein associated with the seventh WD motif of Cdc20.
15020244 2004 USAG-1: a bone morphogenetic protein antagonist abundantly expressed in the kidney.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14623234 2003 Identification of a secreted BMP antagonist, ectodin, integrating BMP, FGF, and SHH signals from the tooth enamel knot.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.