Property Summary

NCBI Gene PubMed Count 162
PubMed Score 488.47
PubTator Score 326.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
psoriasis -1.400 1.8e-07
non-small cell lung cancer -1.318 5.6e-12
intraductal papillary-mucinous adenoma (... -1.100 4.5e-03
intraductal papillary-mucinous neoplasm ... -1.100 1.4e-02
lung cancer -2.200 5.5e-05
breast carcinoma -2.600 2.0e-05
fibroadenoma -2.400 2.9e-03
lung adenocarcinoma -1.100 2.5e-03
invasive ductal carcinoma -2.500 1.4e-03
lung carcinoma 1.600 5.9e-09
ductal carcinoma in situ -1.900 3.0e-04

 OMIM Phenotype (1)

Gene RIF (149)

PMID Text
26006040 Extracellular superoxide dismutase ameliorates streptozotocin-induced rat diabetic nephropathy via inhibiting the ROS/ERK1/2 signaling.
25894370 ECSOD Ala40Thr polymorphism, a significant association was observed between this polymorphism and HCC risk in non-hepatitis B virus (HBV) carriers but not in HBV carriers
25855220 The T-allele of rs2284659 in the promoter of SOD3 was associated with better cardiovascular outcomes in diabetic patients.
25751262 SOD3 regulates the expression of multiple components of small G protein GTPase signal pathways.
25749103 Expression of extracellular superoxide dismutase (EC-SOD) and expression of the prooxidant gene NADPH oxidase 4 was decreased significantly by trichostatin A.
25634994 These results support the hypothesis that loss of extracellular SOD contributes to the invasive phenotype of pancreatic ductal adenocarcinoma
25496033 FXR may regulate SOD3 expression to suppress reactive oxygen species production, resulting in decreasing JNK activity.
25358638 Sod3 is a critical mediator of VEGF-C-induced breast cancer metastasis.
25332062 The combination of serum S100A9, SOD3, and MMP9 levels could achieve 92.5% sensitivity and 95% specificity to discriminate between pulmonary tuberculosis and healthy controls.
25130429 The treatment with E2 suppressed, whereas VC and Res prevented E2-mediated decrease in the expression levels of SOD3, NQO1, Nrf2 mRNA, and protein in MCF-10A cells
25085920 the rs1799895 polymorphism in extracellular superoxide dismutase affects cardiopulmonary disease risk by altering protein distribution
24922645 Loss of SOD3 is associated with prostate cancer.
24658925 No any significantly association between SOD3 rs2695232 polymorphism and seminal superoxide dismutase activity.
24509158 These results demonstrate that the transcription factor HIF-1alpha and its important gene target VEGF can be modulated by the antioxidant enzyme EcSOD.
24155217 We analyzed genes of the superoxide dismutase family (SOD1, SOD2, and SOD3) that are part of a major antioxidative stress system in human in order to detect the genetic variants contributing to the development of ASD.
24146173 Results suggest that there is no considerable influence of sequence variation in SOD3 on human longevity in Germans.
24038157 The less common allele in SOD3 rs699473 was associated with an increased risk of high-grade prostate cancer (T > C: OR = 1.40, 95% CI: 1.04-1.89).
23979608 the impact of Glutamate carboxypeptidase II (GCPII) haplotypes on the expression of PSMA, BNIP3, Ec-SOD, GSTP1 and RASSF1 genes were elucidated to understand the epigenetic basis of oxidative stress and prostate cancer risk.
23977988 The hEC-SOD protein was expressed in the egg white and showed antioxidant activity.
23638916 If oxidative stress is an important mechanism in POAG-related retinal ganglion cell death, genetic variations in SOD1, SOD2 and SOD3 are not major contributors in the pathogenesis.
23620962 There is a positive relationship between the prolactinoma severity and serum EC-SOD.
23318435 Data suggest that epigenetic silencing of EcSOD may contribute to mammary tumorigenesis and that restoring the extracellular superoxide scavenging activity could be an effective strategy for breast cancer treatment.
23289810 If genetic variation in genes encoding SOD-1, SOD-2 and SOD-3 contributes to cataract formation, there is no major contribution of the SNPs analyzed in the present study.
23241403 Antioxidant enzyme, SOD3, reverses DNA damage response and cellular transdifferentiation in aortic valve sclerosis.
23160801 results suggest aberrations in one-carbon metabolism appear to induce altered gene expression of EC-SOD, GSTP1, and BNIP3, and thus contribute to the increased oxidative stress and increased susceptibility to coronary artery disease
23027624 studies further demonstrate that SOD3, but not SOD2 and SOD1, is induced by antioxidants and is regulated through NRF2; SOD3 may thus be an important gene in defense against oxidative stress and in the prevention of estrogen-mediated breast cancer
22958044 Genetic polymorphisms of antioxidant enzymes in preterm infants.
22836756 miR-21 promotes tumorigenesis and key targets of miR-21 in mediating this function were SOD3 and TNFalpha.
22816678 Overexpression of EC-SOD combined with neutrophil blockade protects transgenic mice from hyperoxia-induced lung injury.
22432908 Higher frequency of both Ala-9Val Mn-SOD and Arg213Gly EC-SOD polymorphisms was found in women with preeclampsia compared to women with normal pregnancies.
22313459 results suggest that the expression of Extracellular-superoxide dismutase (EC-SOD)was increased by TPA administration, and it was speculated that the activation of PKC, MEK/ERK and an increase of intracellular ROS were necessary for the induction of EC-SOD in THP-1 cells
22217996 an alteration in SOD3 expression and activity could be associated to Systemic sclerosis (SSc) fibrosis.
22132904 Mesenchymal stem cell-derived chondrocytes, adipocytes, and osteocytes secrete an active and functional SOD3 enzyme.
22064654 The loss of EcSOD expression is unique among the superoxide dismutases in lung cancer and is the result of EcSOD promoter methylation and LOH, suggesting that its early loss may contribute to ECM remodeling and malignant progression.
21957979 The SOD3 might provide an effective strategy for the treatment of HAF-mediated skin inflammation.
21781513 There were no significant differences in the distribution of the different genotypes or allele gene frequencies in the EC-SOD genes between the patients and the controls.
21641397 Extracellular superoxide dismutase facilitates clearance of bacteria and limits inflammation in response to infection by promoting bacterial phagocytosis.
21621610 elevated sputum levels in smokers and in COPD patients
21554548 Mushroom lectin strongly prevented sodium arsenite-induced damage of SOD production pathway in hepatocytes.
21493784 Extracellular superoxide dismutase cell-specific and interferon-gamma-inducible expression in pulmonary artery cells is regulated, to a major degree, by epigenetic mechanisms that include histone acetylation and DNA methylation.
21362472 Polymorphisms in human ecSOD have also been reported and it appears logical to assume that such variations may have a profound effect on disease susceptibility.
21351093 Results suggest that NQO2, SOD2 and SOD3 may significantly modify prognosis of breast cancer patients.
21080077 hC-SOD3 has the potential to penetrate and translocate cargo molecules into cells and has no cytotoxicity at effective concentration.
21077778 hEC-SOD gene transfer protects against oxidative stress-impaired NO bioavailability in alveolar epithelial cells both in vitro and in the lung in vivo.
21077177 Extracellular-superoxide dismutase expression during monocytic differentiation of U937 cells
20966810 The first European study of the SOD2, SOD3, NQO1, and NQO2 roles in pancreatic cancer etiology did not find significant associations.
20966810 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
20673868 Observational study of gene-disease association. (HuGE Navigator)
20673035 polymorphisms in the SOD3 gene were associated with CT emphysema but not COPD susceptibility
20673035 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20600835 The interaction between LRP and EC-SOD is thus likely to be important for maintaining redox balance in the circulation.
20576801 Down-regulation of SOD3 is associated with thyroid cancer.
20514411 CuZnSOD and MnSOD may suppress tumour growth through inhibiting metabolic stress-induced necrosis and HMGB1 release via inhibiting metabolic stress-induced mitochondrial ROS production.
20485444 Observational study of gene-disease association. (HuGE Navigator)
20477822 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20226522 In preeclampsia, labor upregulates SOD1 in fetal membranes as well as SOD2 and SOD3 in the whole placenta.
20079429 the importance of methylation in the repression of EC-SOD expression; epigenetic modifications play a role in the regulation of EC-SOD expression.
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19933216 Meta-analysis of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19811392 Genetic studies have identified an association between extracellular superoxide dismutase (ECSOD) polymorphisms and risk for developing COPD.
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19705749 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19636420 Studied SOD2Ala - 9Val & SOD3 Arg213Gly polymorphisms as risk factors for asbestosis in workers exposed to asbestos. Asbestosis was associated with the homozygous SOD2 - 9Ala/Ala genotype;the association for SOD3 Arg/Gly genotype was not significant.
19636420 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19533864 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19526392 SOD3 R231G polymorphism associated with coronary artery disease and myocardial infarction.
19526392 Observational study of gene-disease association. (HuGE Navigator)
19505917 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19495415 SOD3 has a selective anti-inflammatory role in ischemic damages preventing the migration of reactive oxygen producing monocyte/macrophages
19488773 lower circulatory levels antioxidant activity in vitiligo Indian patients
19423540 Observational study of gene-disease association. (HuGE Navigator)
19423521 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19390575 Observational study of gene-disease association. (HuGE Navigator)
19318538 Two common SOD3 SNPs were found associated with decreased forced expiratory volume and decreased maximal expiratory flow volume.
19318538 Human SOD3 genetic variants are associated with lower lung function in children
19289127 crystal structure of human SOD3 at 1.7 A resolution; binding sites
19242068 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19213780 The Arg213Gly snp in SOD3 has a protective effect on the FEV in never-smokers. The G(-4466)T(rs8192288) SOD3 snp is associated with the level of vital capacity in the general population.
19213780 Observational study of gene-disease association. (HuGE Navigator)
19200140 The C-C-C haplotypes could be genetic markers for cerebral infarction, and the EC-SOD gene may be a susceptibility gene for CI in women.
19200140 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19108943 Carriers of the Ala40Thr single nucleotide polymorphism showed an increased risk for severe fetal growth restriction-complicated pre-eclampsia.
19108943 Observational study of gene-disease association. (HuGE Navigator)
19016244 Observational study of gene-disease association. (HuGE Navigator)
18977241 Observational study of gene-disease association. (HuGE Navigator)
18971527 Based on the results of our haplotype-based case-control study, the T-A haplotype may be a genetic marker for essential hypertension, and thus the EC-SOD gene might be a susceptibility gene for it
18971527 Observational study of gene-disease association. (HuGE Navigator)
18948423 Observational study of gene-disease association. (HuGE Navigator)
18726685 Observational study of gene-disease association. (HuGE Navigator)
18720901 Observational study of genotype prevalence. (HuGE Navigator)
18703790 two novel polymorphisms in a conserved region of the SOD3 gene are associated with lung function or chronic obstructive pulmonary disease
18682580 common variants in the SOD2, SOD3, and CAT genes may influence brain tumor risk.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18599502 chronic hypoxia decreased lung EC-SOD activity and protein expression in wild-type mice, but EC-SOD activity remained five to seven times higher in EC-SOD TG mice under hypoxic conditions
18385137 generation of the EC-SOD folding variants is an intracellular event that depends on a free cysteine residue not involved in disulfide bonding.
18314536 Sp1 and Sp3 plays role in regulating the expression of human EC-SOD in the lung.
18165226 inhibition of oxidative hyaluronan fragmentation probably represents one mechanism by which EC-SOD inhibits inflammation in response to lung injury.
18160848 Cell-permeable SOD inhibits the activation of MAP kinases including ERK, JNK and p38 and the upregulation of ICAM-1 and VCAM-1 by HIV-1 Tat
17937792 Variation in enzymatic potency of 3 dimers of EC-SOD can regulate antioxidant level in the extracellular space and represents a novel way of modulating enzymatic activity.
17717013 Common human gene variant of ECSOD fails to protect against endothelial dysfunction produced by an inflammatory stimulus.
17679946 Cultured keratoconus stromal cells respond with a reduced SOD3 synthesis to interleukin-1alpha, which is not the case in corresponding normal or bullous keratopathy cells.
17646272 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17646272 No significant association with prostate cancer was observed for polymorphic variants in SOD3.
17601350 Observational study of gene-disease association. (HuGE Navigator)
17296902 Observational study of gene-disease association. (HuGE Navigator)
17070542 we present the crystal structure of fully cysteine-depleted human SOD (SOD(CallA)), representing a reduced, marginally stable intermediate on the folding pathway in vivo that has also been implicated as neurotoxic precursor state.
17023265 Reduction in extracellular superoxide dismutase activity is associated with hypertension
16899934 the decrease of antioxidant defense strategies play a primary role by compromising NO availability in normally aged individuals, particularly through a progressive decrease of EC-SOD activity
16842247 consistent with several other antioxidant enzymes, ECSOD is very low in fibrotic areas of idiopathic pulmonary fibrosis/usual interstitial pneumonia, which may further increase the oxidant burden in this disease
16809550 Is endocytosed into endothelial cells through clathrin-mediated pathway, but does not translocate to the nucleus. Impairment of endocytosis may contribute to high plasma levels of EC-SOD(R213G) in R213G carriers.
16792821 Cell-permeable SOD inhibits the activation of MAP kinases including ERK, JNK and p38 and the upregulation of ICAM-1 and VCAM-1 by HIV-1 Tat
16611809 EC-SOD expression in aged transgenic mice impaired contextual learning, but the impairment was decreased in the aged transgenic mice.
16540901 The roles these SOD isoforms, especially SOD3, play in both normal nasal mucosa and NP require further clarification.
16469315 EC-SOD with high affinity for heparin-Sepharose formed not only a tetramer but also an octamer composed of both aEC-SOD and iEC-SOD folding variants
16467073 Observational study of gene-disease association. (HuGE Navigator)
16399992 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16399992 Extracellular superoxide dismutase R213G heterozygosity protects against development of COPD in the Danish general population.
16100289 Transgenic hEC-SOD ameliorated the 95% O2-impaired bromodeoxyuridine uptake in alveolar and bronchiolar epithelium at P3, but not at P5 and P7, when overall epithelial proliferation rates were lower in air-exposed wild-type mice.
16014615 A common gene variant in the heparin-binding domain of ecSOD, which is a risk factor for ischemic heart disease, may be a risk factor for vascular maladaptation and endothelial dysfunction in heart failure.
15990193 Observational study of gene-disease association. (HuGE Navigator)
15899505 EC-SOD gene mutations were screened in a sample of southern Italian population.
15869407 Cell-permeable SOD inhibits the activation of MAP kinases including ERK, JNK and p38 and the upregulation of ICAM-1 and VCAM-1 by HIV-1 Tat
15761197 Atox1 functions not only as a copper chaperone for SOD3 but also as a positive regulator for SOD3 transcription and may have an important role in modulating oxidative stress in the cardiovascular system.
15528465 EcSOD-fibulin-5 interaction is needed for ecSOD binding to vascular tissues, regulating their O2*- levels. This is a new mechanism for controlling vascular redox state in the extracellular space in cardiovascular diseases with high oxidative stress.
15223067 Cell-permeable SOD inhibits the activation of MAP kinases including ERK, JNK and p38 and the upregulation of ICAM-1 and VCAM-1 by HIV-1 Tat
15166009 Review. Blood vessels express 3 isoforms of superoxide dismutase SOD, 1 of which is an extracellular form of CuZn-SOD. This review will focus mainly on the role of individual SODs in relation to endothelium under normal conditions and in disease states.
15044467 intracellular proteolytic processing of extracellular superoxide dismutase is a two-step event
14975589 Cell-permeable SOD inhibits the activation of MAP kinases including ERK, JNK and p38 and the upregulation of ICAM-1 and VCAM-1 by HIV-1 Tat
14704872 Observational study of gene-disease association. (HuGE Navigator)
14619883 Chromosome mapping of SOD3 to chromosome band 4p15.3-->p15.1.
14592844 EC-SOD may play an important protective role against increased oxidative stress during acute ischemic coronary events.
12830380 There is lower activity in diabetic compared with normal subjects.
12815947 Observational study of gene-disease association. (HuGE Navigator)
12815947 Higher frequencies of SOD2 allele Val and genotype Val/Val and of SOD3 allele Arg and genotype Arg/Arg were established for group DPN+. On this evidence, SOD2 and SOD3 were associated with DPN in DM type 1.
12663605 In NIDDM serum EC-SOD concentration levels may be a marker of vascular injury, possibly reflecting hyperglycemia-induced oxidative injury to the vascular endothelium.
12475988 EC-SOD has a role as an antioxidant gene product in human fibroblasts
12052468 prevents endothelial cell-mediated oxidative modification of LDL
11861638 Furin proteolytically processes the heparin-binding region of extracellular superoxide dismutase
11299047 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLALLCSCLLLAAGASDAWTGEDSAEPNSDSAEWIRDMYAKVTEIWQEVMQRRDDDGALHAACQVQPSAT      1 - 70
LDAAQPRVTGVVLFRQLAPRAKLDAFFALEGFPTEPNSSSRAIHVHQFGDLSQGCESTGPHYNPLAVPHP     71 - 140
QHPGDFGNFAVRDGSLWRYRAGLAASLAGPHSIVGRAVVVHAGEDDLGRGGNQASVENGNAGRRLACCVV    141 - 210
GVCGPGLWERQAREHSERKKRRRESECKAA                                            211 - 240
//

Text Mined References (164)

PMID Year Title
26006040 2015 Extracellular superoxide dismutase ameliorates streptozotocin-induced rat diabetic nephropathy via inhibiting the ROS/ERK1/2 signaling.
25894370 2015 Genetic polymorphisms in antioxidant enzyme genes and susceptibility to hepatocellular carcinoma in Chinese population: a case-control study.
25855220 2015 Plasma extracellular superoxide dismutase concentration, allelic variations in the SOD3 gene and risk of myocardial infarction and all-cause mortality in people with type 1 and type 2 diabetes.
25751262 2015 Extracellular superoxide dismutase regulates the expression of small gtpase regulatory proteins GEFs, GAPs, and GDI.
25749103 2015 Regulation of Oxidative Stress in Pulmonary Artery Endothelium. Modulation of Extracellular Superoxide Dismutase and NOX4 Expression Using Histone Deacetylase Class I Inhibitors.
25644107 2015 Extracellular Superoxide Dismutase Protects against Proteinuric Kidney Disease.
25634994 2015 Loss of SOD3 (EcSOD) Expression Promotes an Aggressive Phenotype in Human Pancreatic Ductal Adenocarcinoma.
25496033 2015 Farnesoid X receptor antagonizes JNK signaling pathway in liver carcinogenesis by activating SOD3.
25416956 2014 A proteome-scale map of the human interactome network.
25358638 2014 Vascular endothelial growth factor C promotes breast cancer progression via a novel antioxidant mechanism that involves regulation of superoxide dismutase 3.
25332062 2015 Serum protein S100A9, SOD3, and MMP9 as new diagnostic biomarkers for pulmonary tuberculosis by iTRAQ-coupled two-dimensional LC-MS/MS.
25326578 2014 Selective depletion of vascular EC-SOD augments chronic hypoxic pulmonary hypertension.
25130429 2014 Natural antioxidants exhibit chemopreventive characteristics through the regulation of CNC b-Zip transcription factors in estrogen-induced breast carcinogenesis.
25085920 2014 A common polymorphism in extracellular superoxide dismutase affects cardiopulmonary disease risk by altering protein distribution.
24922645 2014 SOD3 acts as a tumor suppressor in PC-3 prostate cancer cells via hydrogen peroxide accumulation.
24658925 2014 Seminal superoxide dismutase activity and its relationship with semen quality and SOD gene polymorphism.
24509158 2014 Extracellular superoxide dismutase suppresses hypoxia-inducible factor-1? in pancreatic cancer.
24155217 2014 Rare single nucleotide polymorphisms in the regulatory regions of the superoxide dismutase genes in autism spectrum disorder.
24146173 2013 Polymorphisms in the superoxidase dismutase genes reveal no association with human longevity in Germans: a case-control association study.
24038157 2013 Antioxidant and vitamin E transport genes and risk of high-grade prostate cancer and prostate cancer recurrence.
23979608 2013 GCPII modulates oxidative stress and prostate cancer susceptibility through changes in methylation of RASSF1, BNIP3, GSTP1 and Ec-SOD.
23977988 2013 Human extracellular superoxide dismutase (EC-SOD) expression in transgenic chicken.
23638916 2014 Genetic variation of superoxide dismutases in patients with primary open-angle glaucoma.
23620962 2012 Extracellular superoxide dismutase, a potential extracellular biomarker candidate for prolactinoma.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23377640 2013 Common genetic variation and antidepressant efficacy in major depressive disorder: a meta-analysis of three genome-wide pharmacogenetic studies.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23318435 2014 Epigenetic reprogramming governs EcSOD expression during human mammary epithelial cell differentiation, tumorigenesis and metastasis.
23289810 2013 Superoxide dismutase gene polymorphisms in patients with age-related cataract.
23241403 2013 Antioxidant enzymes reduce DNA damage and early activation of valvular interstitial cells in aortic valve sclerosis.
23160801 2013 Oxidative stress in coronary artery disease: epigenetic perspective.
23027624 2012 Superoxide dismutase 3 is induced by antioxidants, inhibits oxidative DNA damage and is associated with inhibition of estrogen-induced breast cancer.
22958044 2012 Genetic polymorphisms of antioxidant enzymes in preterm infants.
22836756 2012 MicroRNA-21 modulates the levels of reactive oxygen species by targeting SOD3 and TNF?.
22816678 2012 Synergistic protection against hyperoxia-induced lung injury by neutrophils blockade and EC-SOD overexpression.
22432908 2012 The Ala-9Val (Mn-SOD) and Arg213Gly (EC-SOD) polymorphisms in the pathogenesis of preeclampsia in Romanian women: association with the severity and outcome of preeclampsia.
22313459 2012 TPA induces the expression of EC-SOD in human monocytic THP-1 cells: involvement of PKC, MEK/ERK and NOX-derived ROS.
22217996 Analysis of extracellular superoxide dismutase in fibroblasts from patients with systemic sclerosis.
22132904 2012 Changes in expression of the antioxidant enzyme SOD3 occur upon differentiation of human bone marrow-derived mesenchymal stem cells in vitro.
22064654 2012 Genetic and epigenetic inactivation of extracellular superoxide dismutase promotes an invasive phenotype in human lung cancer by disrupting ECM homeostasis.
21957979 2012 Superoxide dismutase 3 suppresses hyaluronic acid fragments mediated skin inflammation by inhibition of toll-like receptor 4 signaling pathway: superoxide dismutase 3 inhibits reactive oxygen species-induced trafficking of toll-like receptor 4 to lipid rafts.
21781513 2011 [Superoxide dismutase gene polymorphisms and functional activity in chronic obstructive pulmonary disease].
21641397 2011 Extracellular superoxide dismutase in macrophages augments bacterial killing by promoting phagocytosis.
21621610 2011 Smoking and COPD increase sputum levels of extracellular superoxide dismutase.
21554548 2011 Sodium arsenite-induced alteration in hepatocyte function of rat with special emphasis on superoxide dismutase expression pathway and its prevention by mushroom lectin.
21493784 2011 Histone acetylation regulates the cell-specific and interferon-?-inducible expression of extracellular superoxide dismutase in human pulmonary arteries.
21473702 2011 Superoxide dismutases: role in redox signaling, vascular function, and diseases.
21362472 2011 Allele-specific effects of ecSOD on asbestos-induced fibroproliferative lung disease in mice.
21351093 2012 Association of superoxide dismutases and NAD(P)H quinone oxidoreductases with prognosis of patients with breast carcinomas.
21080077 2011 A novel human derived cell-penetrating peptide in drug delivery.
21077778 2011 The protective effect of overexpression of extracellular superoxide dismutase on nitric oxide bioavailability in the lung after exposure to hyperoxia stress.
21077177 2011 Extracellular-superoxide dismutase expression during monocytic differentiation of U937 cells.
20966810 2011 Superoxide dismutase and nicotinamide adenine dinucleotide phosphate: quinone oxidoreductase polymorphisms and pancreatic cancer risk.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20673035 2010 Polymorphisms in the superoxide dismutase-3 gene are associated with emphysema in COPD.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20600835 2010 The concentration of extracellular superoxide dismutase in plasma is maintained by LRP-mediated endocytosis.
20576801 2010 Extracellular superoxide dismutase is a thyroid differentiation marker down-regulated in cancer.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
20514411 2010 CuZnSOD and MnSOD inhibit metabolic stress-induced necrosis and multicellular tumour spheroid growth.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20477822 2011 Single-nucleotide polymorphisms within the antioxidant defence system and associations with aggressive prostate cancer.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20226522 2010 Effects of labor on placental expression of superoxide dismutases in preeclampsia.
20079429 2010 CpG methylation attenuates Sp1 and Sp3 binding to the human extracellular superoxide dismutase promoter and regulates its cell-specific expression.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19933216 2010 The COPD genetic association compendium: a comprehensive online database of COPD genetic associations.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19811392 2009 Extracellular superoxide dismutase and risk of COPD.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19705749 2009 [Polymorphism of the genes for antioxidant defense enzymes and their association with the development of chronic obstructive pulmonary disease in the population of Bashkortostan].
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19636420 2009 Manganese and extracellular superoxide dismutase polymorphisms and risk for asbestosis.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19533864 2008 Genetic polymorphisms of xenobiotic enzymes affect human vitamin C excretion.
19526392 2009 SOD3 R231G polymorphism associated with coronary artery disease and myocardial infarction. The Ludwigshafen Risk and Cardiovascular Health (LURIC) study.
19505917 2009 Lead exposure, polymorphisms in genes related to oxidative stress, and risk of adult brain tumors.
19495415 2009 SOD3 reduces inflammatory cell migration by regulating adhesion molecule and cytokine expression.
19488773 2009 Circulatory levels of antioxidants and lipid peroxidation in Indian patients with generalized and localized vitiligo.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19423521 2009 Genetic polymorphisms in nitric oxide synthase genes modify the relationship between vegetable and fruit intake and risk of non-Hodgkin lymphoma.
19390575 2009 Lung cancer susceptibility model based on age, family history and genetic variants.
19318538 2009 Superoxide dismutase 3, extracellular (SOD3) variants and lung function.
19289127 2009 The structure of human extracellular copper-zinc superoxide dismutase at 1.7 A resolution: insights into heparin and collagen binding.
19242068 2009 Genetic polymorphisms modifying oxidative stress are associated with disease activity in rheumatoid arthritis patients.
19213780 2009 Superoxide dismutases, lung function and bronchial responsiveness in a general population.
19200140 2008 Association of extracellular superoxide dismutase gene with cerebral infarction in women: a haplotype-based case-control study.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19108943 2009 Association of extracellular superoxide dismutase (SOD3) Ala40Thr gene polymorphism with pre-eclampsia complicated by severe fetal growth restriction.
19016244 2008 Multiplex single base extension method for simultaneous genotyping of non-synonymous SNP in the three human SOD genes.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18971527 2008 A haplotype-based case-control study examining human extracellular superoxide dismutase gene and essential hypertension.
18948423 2009 Extracellular superoxide dismutase haplotypes are associated with acute lung injury and mortality.
18726685 2008 Polymorphic variants of extracellular superoxide dismutase gene in a Romanian population with atheroma.
18720901 2008 Genetic profiling of genes from the oxidative stress pathway among North and South Indians.
18703790 2008 Superoxide dismutase 3 polymorphism associated with reduced lung function in two large populations.
18682580 2008 Oxidative response gene polymorphisms and risk of adult brain tumors.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18599502 2008 Lung EC-SOD overexpression attenuates hypoxic induction of Egr-1 and chronic hypoxic pulmonary vascular remodeling.
18385137 2008 The folding of human active and inactive extracellular superoxide dismutases is an intracellular event.
18314536 2008 Transcription factors sp1 and sp3 regulate expression of human extracellular superoxide dismutase in lung fibroblasts.
18165226 2008 Extracellular superoxide dismutase inhibits inflammation by preventing oxidative fragmentation of hyaluronan.
17937792 2007 The subunit composition of human extracellular superoxide dismutase (EC-SOD) regulates enzymatic activity.
17717013 2007 Effects of a common human gene variant of extracellular superoxide dismutase on endothelial function after endotoxin in mice.
17679946 2007 Interleukin-1alpha downregulates extracellular-superoxide dismutase in human corneal keratoconus stromal cells.
17646272 2007 Functional variant of manganese superoxide dismutase (SOD2 V16A) polymorphism is associated with prostate cancer risk in the prostate, lung, colorectal, and ovarian cancer study.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
17296902 2007 Nitric oxide synthase and superoxide dismutase gene polymorphisms in Behçet disease.
17070542 2007 The coupling between disulphide status, metallation and dimer interface strength in Cu/Zn superoxide dismutase.
17023265 2006 Reduction in extracellular superoxide dismutase activity in African-American patients with hypertension.
16899934 2006 Impairment of plasma nitric oxide availability in senescent healthy individuals: apparent involvement of extracellular superoxide dismutase activity.
16842247 2006 Extracellular superoxide dismutase has a highly specific localization in idiopathic pulmonary fibrosis/usual interstitial pneumonia.
16809550 2006 Endocytosis of extracellular superoxide dismutase into endothelial cells: role of the heparin-binding domain.
16611809 2006 Aging-dependent alterations in synaptic plasticity and memory in mice that overexpress extracellular superoxide dismutase.
16540901 2006 Altered expression profile of superoxide dismutase isoforms in nasal polyps from nonallergic patients.
16469315 2006 Extracellular superoxide dismutase exists as an octamer.
16467073 2006 Functional variants of antioxidant genes in smokers with COPD and in those with normal lung function.
16399992 2006 Genetically increased antioxidative protection and decreased chronic obstructive pulmonary disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16100289 2006 Transgenic extracellular superoxide dismutase protects postnatal alveolar epithelial proliferation and development during hyperoxia.
16087389 2005 Extracellular superoxide dismutase.
16014615 2005 Gene transfer of extracellular superoxide dismutase improves endothelial function in rats with heart failure.
15990193 2006 Extracellular superoxide dismutase gene polymorphism is associated with insulin resistance and the susceptibility to type 2 diabetes.
15899505 2005 Extracellular superoxide dismutase (EC-SOD) gene mutations screening in a sample of Mediterranean population.
15761197 2005 Role of antioxidant-1 in extracellular superoxide dismutase function and expression.
15528465 2004 Fibulin-5 is a novel binding protein for extracellular superoxide dismutase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15166009 2004 Vascular protection: superoxide dismutase isoforms in the vessel wall.
15044467 2004 The intracellular proteolytic processing of extracellular superoxide dismutase (EC-SOD) is a two-step event.
14736885 2004 Extracellular superoxide dismutase (EC-SOD) binds to type i collagen and protects against oxidative fragmentation.
14704872 2003 Predisposing genetic factors for diabetic polyneuropathy in patients with type 1 diabetes: a population-based case-control study.
14662715 2004 Genetically reduced antioxidative protection and increased ischemic heart disease risk: The Copenhagen City Heart Study.
14619883 2003 Assignment of SOD3 to human chromosome band 4p15.3-->p15.1 with somatic cell and radiation hybrid mapping, linkage mapping, and fluorescent in-situ hybridization.
14592844 2004 Upregulation of vascular extracellular superoxide dismutase in patients with acute coronary syndromes.
12885586 2003 Extracellular superoxide dismutase in biology and medicine.
12830380 2003 Long-term hyperglycaemia decreases vascular fraction of extracellular superoxide dismutase.
12815947 [Association of the SOD2 Ala(-9)Val and SOD3 Arg213Gly polymorphisms with diabetic polyneuropathy in patients with diabetes mellitus type 1].
12663605 2003 Serum extracellular superoxide dismutase in patients with type 2 diabetes: relationship to the development of micro- and macrovascular complications.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475988 2003 Extracellular superoxide dismutase is a major antioxidant in human fibroblasts and slows telomere shortening.
12126755 2002 Superoxide dismutase multigene family: a comparison of the CuZn-SOD (SOD1), Mn-SOD (SOD2), and EC-SOD (SOD3) gene structures, evolution, and expression.
12052468 2002 The expression of extracellular-superoxide dismutase is increased by lysophosphatidylcholine in human monocytic U937 cells.
11861638 2002 Furin proteolytically processes the heparin-binding region of extracellular superoxide dismutase.
11299047 2001 Polymorphisms in the Mn-SOD and EC-SOD genes and their relationship to diabetic neuropathy in type 1 diabetes mellitus.
10329680 1999 The heparin-binding domain of extracellular superoxide dismutase is proteolytically processed intracellularly during biosynthesis.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8864862 1996 An arginine-213 to glycine mutation in human extracellular-superoxide dismutase reduces susceptibility to trypsin-like proteinases.
8694786 1996 Human extracellular superoxide dismutase is a tetramer composed of two disulphide-linked dimers: a simplified, high-yield purification of extracellular superoxide dismutase.
8546689 1996 Substitution of glycine for arginine-213 in extracellular-superoxide dismutase impairs affinity for heparin and endothelial cell surface.
8034674 1994 10-fold increase in human plasma extracellular superoxide dismutase content caused by a mutation in heparin-binding domain.
7959763 1994 Extracellular superoxide dismutase (SOD3): tissue-specific expression, genomic characterization, and computer-assisted sequence analysis of the human EC SOD gene.
7662997 1995 Molecular analysis of extracellular-superoxide dismutase gene associated with high level in serum.
6541229 1984 Extracellular superoxide dismutase in human tissues and human cell lines.
3476950 1987 Isolation and sequence of complementary DNA encoding human extracellular superoxide dismutase.
2276747 1990 Regional localization of human extracellular superoxide dismutase gene to 4pter-q21.
2106874 1990 Expression of extracellular superoxide dismutase by human cell lines.
1505778 1992 The site of nonenzymic glycation of human extracellular-superoxide dismutase in vitro.
1477980 1992 Quantitative analysis of extracellular-superoxide dismutase in serum and urine by ELISA with monoclonal antibody.