Property Summary

NCBI Gene PubMed Count 18
PubMed Score 9.86
PubTator Score 8.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 4.7e-04
group 3 medulloblastoma 2254 7.6e-04
ovarian cancer 8491 1.6e-03
Multiple myeloma 1327 5.2e-03
progressive supranuclear palsy 674 1.0e-02
ulcerative colitis 2087 1.5e-02
Disease Target Count Z-score Confidence
Batten disease 15 3.422 1.7

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.204 5.2e-03
psoriasis -1.100 4.7e-04
group 3 medulloblastoma 1.600 7.6e-04
ulcerative colitis -1.077 1.5e-02
progressive supranuclear palsy -1.100 1.0e-02
ovarian cancer 1.300 1.6e-03

Gene RIF (7)

PMID Text
24690921 alpha-taxilin interacts with SNX4 and plays a role in the recycling pathway of TfnR.
21973056 SNX4, but not SNX1 and SNX8, is associated with the Rab11-recycling endosomes and that a high frequency of SNX4-mediated tubule formation is observed as endosomes undergo Rab4-to-Rab11 transition.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19529763 clathrin serving as a regulator of SNX4-dependent transport; upon clathrin release, dynein may bind SNX4 and mediate retrograde movement
17994011 by driving membrane tubulation, SNX4 coordinates iterative, geometric-based sorting of the TfnR with the long-range transport of carriers from early endosomes to the ERC
17319803 study indicates that hVps34 and its product PI(3)P are involved in endosome to Golgi transport of ricin, and that SNX2 and SNX4 are likely to be effectors in this pathway
12668730 Sorting nexin 4 and amphiphysin 2 have roles in endocytosis and intracellular trafficking

AA Sequence

MEQAPPDPERQLQPAPLEPLGSPDAGLGAAVGKEAEGAGEESSGVDTMTHNNFWLKKIEISVSEAEKRTG      1 - 70
RNAMNMQETYTAYLIETRSVEHTDGQSVLTDSLWRRYSEFELLRSYLLVYYPHIVVPPLPEKRAEFVWHK     71 - 140
LSADNMDPDFVERRRIGLENFLLRIASHPILCRDKIFYLFLTQEGNWKETVNETGFQLKADSRLKALNAT    141 - 210
FRVKNPDKRFTDLKHYSDELQSVISHLLRVRARVADRLYGVYKVHGNYGRVFSEWSAIEKEMGDGLQSAG    211 - 280
HHMDVYASSIDDILEDEEHYADQLKEYLFYAEALRAVCRKHELMQYDLEMAAQDLASKKQQCEELVTGTV    281 - 350
RTFSLKGMTTKLFGQETPEQREARIKVLEEQINEGEQQLKSKNLEGREFVKNAWADIERFKEQKNRDLKE    351 - 420
ALISYAVMQISMCKKGIQVWTNAKECFSKM                                            421 - 450
//

Text Mined References (23)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24690921 2014 ?-Taxilin interacts with sorting nexin 4 and participates in the recycling pathway of transferrin receptor.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23085988 2012 Molecular basis for SNX-BAR-mediated assembly of distinct endosomal sorting tubules.
21973056 2012 SNX-BAR-mediated endosome tubulation is co-ordinated with endosome maturation.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19529763 2009 SNX4 in complex with clathrin and dynein: implications for endosome movement.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18253931 2008 Vesicle associated membrane protein (VAMP)-7 and VAMP-8, but not VAMP-2 or VAMP-3, are required for activation-induced degranulation of mature human mast cells.
17994011 2007 SNX4 coordinates endosomal sorting of TfnR with dynein-mediated transport into the endocytic recycling compartment.
17319803 2007 Phosphoinositide-regulated retrograde transport of ricin: crosstalk between hVps34 and sorting nexins.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12668730 2003 Sorting nexin 4 and amphiphysin 2, a new partnership between endocytosis and intracellular trafficking.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11279102 2001 Sorting nexin 6, a novel SNX, interacts with the transforming growth factor-beta family of receptor serine-threonine kinases.
11278302 2001 Transforming growth factor-beta receptor-associated protein 1 is a Smad4 chaperone.
9819414 1998 Identification of a family of sorting nexin molecules and characterization of their association with receptors.