Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 0.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.500 3.5e-02
atypical teratoid / rhabdoid tumor -1.500 4.8e-05
ependymoma -1.900 4.7e-02
lung carcinoma -1.500 3.4e-18
non-small cell lung cancer -1.541 8.2e-20
ovarian cancer -1.600 2.5e-06
subependymal giant cell astrocytoma -1.996 1.1e-02
tuberculosis and treatment for 6 months 1.100 1.0e-04
ulcerative colitis -1.700 2.0e-08

Synonym

Accession Q5VWJ9
Symbols ATG24A

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MAGGPPKALPSTGPHSLRDMPHPLAGSSSEEAVGGDSTPSPDLLMARSFGDKDLILPNGGTPAGTSSPAS      1 - 70
SSSLLNRLQLDDDIDGETRDLFVIVDDPKKHVCTMETYITYRITTKSTRVEFDLPEYSVRRRYQDFDWLR     71 - 140
SKLEESQPTHLIPPLPEKFVVKGVVDRFSEEFVETRRKALDKFLKRITDHPVLSFNEHFNIFLTAKDLNA    141 - 210
YKKQGIALLTRMGESVKHVTGGYKLRTRPLEFAAIGDYLDTFALKLGTIDRIAQRIIKEEIEYLVELREY    211 - 280
GPVYSTWSALEGELAEPLEGVSACIGNCSTALEELTDDMTEDFLPVLREYILYSDSMKSVLKKRDQVQAE    281 - 350
YEAKLEAVALRKEDRPKVPADVEKCQDRMECFNADLKADMERWQNNKRQDFRQLLMGMADKNIQYYEKCL    351 - 420
MAWESIIPLLQEKQEAK                                                         421 - 437
//

Text Mined References (9)

PMID Year Title