Property Summary

NCBI Gene PubMed Count 10
PubMed Score 6.64
PubTator Score 3.74

Knowledge Summary


No data available


  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell -1.200 7.7e-05
diabetes mellitus -1.100 1.0e-03
ovarian cancer -1.300 4.4e-06

Gene RIF (3)

25848753 A unique ataxia syndrome due to biallelic SNX14 mutations leading to lysosome-autophagosome dysfunction.
25439728 Mutations in SNX14 cause a distinctive autosomal-recessive cerebellar ataxia and intellectual disability syndrome.
25148684 SNX19 and SNX14 PX domains reveal key differences in spatial control of RGS-PX proteins in cell signaling and trafficking.

AA Sequence

VLNKQLTYVLLDIVIQELFPELNKVQKEVTSVTSWM                                      911 - 946

Text Mined References (12)

PMID Year Title
25848753 2015 Biallelic mutations in SNX14 cause a syndromic form of cerebellar atrophy and lysosome-autophagosome dysfunction.
25439728 2014 Mutations in SNX14 cause a distinctive autosomal-recessive cerebellar ataxia and intellectual disability syndrome.
25148684 2014 Structural basis for different phosphoinositide specificities of the PX domains of sorting nexins regulating G-protein signaling.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12461558 2002 Sorting out the cellular functions of sorting nexins.
11736640 2001 The Phox homology (PX) domain, a new player in phosphoinositide signalling.
11500980 2001 Sorting nexin-14, a gene expressed in motoneurons trapped by an in vitro preselection method.
11485546 2001 A large family of endosome-localized proteins related to sorting nexin 1.