Property Summary

NCBI Gene PubMed Count 55
PubMed Score 37.97
PubTator Score 18.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
dermatomyositis 1.100 3.7e-04
group 3 medulloblastoma 1.200 2.3e-04
lung cancer 1.200 2.9e-02
Multiple myeloma 1.062 1.3e-02
ovarian cancer 1.700 1.0e-03
Waldenstrons macroglobulinemia 1.628 1.5e-03

Gene RIF (3)

AA Sequence

MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRF      1 - 70
LILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR                   71 - 126
//

Text Mined References (61)

PMID Year Title