Property Summary

NCBI Gene PubMed Count 24
PubMed Score 30.93
PubTator Score 24.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung cancer 4473 1.5e-04

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer 1.300 1.5e-04

Gene RIF (4)

PMID Text
25625564 these studies establish potentially converging disease mechanisms in amyotrophic lateral sclerosis (ALS) and spinal muscular atrophy, with ALS-causative mutants acquiring properties representing both gain and loss of function.
22174317 HIV-1 Rev interacting protein, small nuclear ribonucleoprotein polypeptide C (SNRPC), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
18854154 Knockdown of small nuclear ribonucleoprotein polypeptide C (SNRPC) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
12486009 binding of TIA-1 in the vicinity of a 5' ss helps to stabilize U1 snRNP recruitment, at least in part, via a direct interaction with U1-C

AA Sequence

MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAP      1 - 70
PPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMR     71 - 140
PPARPMMVPTRPGMTRPDR                                                       141 - 159
//

Text Mined References (34)

PMID Year Title
25625564 2015 ALS-causative mutations in FUS/TLS confer gain and loss of function by altered association with SMN and U1-snRNP.
24871463 2014 GWAS identifies novel SLE susceptibility genes and explains the association of the HLA region.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21269460 2011 Initial characterization of the human central proteome.
21113136 2010 Functional organization of the Sm core in the crystal structure of human U1 snRNP.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19325628 2009 Crystal structure of human spliceosomal U1 snRNP at 5.5 A resolution.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
15635413 2005 Nucleolar proteome dynamics.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15525645 2005 Protein stoichiometry of a multiprotein complex, the human spliceosomal U1 small nuclear ribonucleoprotein: absolute quantification using isotope-coded tags and mass spectrometry.
15312772 2004 The structure and biochemical properties of the human spliceosomal protein U1C.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12486009 2002 The splicing regulator TIA-1 interacts with U1-C to promote U1 snRNP recruitment to 5' splice sites.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11748230 2002 Purification of native survival of motor neurons complexes and identification of Gemin6 as a novel component.
10827180 2000 The splicing factor U1C represses EWS/FLI-mediated transactivation.
10725331 2000 Gemin4. A novel component of the SMN complex that is found in both gems and nucleoli.
10068039 1998 Human monoclonal autoantibody fragments from combinatorial antibody libraries directed to the U1snRNP associated U1C protein; epitope mapping, immunolocalization and V-gene usage.
9826776 1998 At least three linear regions but not the zinc-finger domain of U1C protein are exposed at the surface of the protein in solution and on the human spliceosomal U1 snRNP particle.
9031639 1997 Cloning and characterization of two processed pseudogenes and the cDNA for the murine U1 snRNP-specific protein C.
8972845 1996 In vitro reconstitution of mammalian U1 snRNPs active in splicing: the U1-C protein enhances the formation of early (E) spliceosomal complexes.
8798632 1996 Involvement of U1 small nuclear ribonucleoproteins (snRNP) in 5' splice site-U1 snRNP interaction.
8532530 1995 Homodimerization of the human U1 snRNP-specific protein C.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8076607 1994 The association of the U1-specific 70K and C proteins with U1 snRNPs is mediated in part by common U snRNP proteins.
2971157 1988 Human U1 snRNP-specific C protein: complete cDNA and protein sequence and identification of a multigene family in mammals.
2961811 1988 Isolation and characterization of a complementary DNA expressing human U1 small nuclear ribonucleoprotein C polypeptide.
2136774 1990 U1-specific protein C needed for efficient complex formation of U1 snRNP with a 5' splice site.
1826349 1991 Zinc finger-like structure in U1-specific protein C is essential for specific binding to U1 snRNP.