Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.33
PubTator Score 5.43

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

 GO Function (2)

Gene RIF (2)

AA Sequence

MNDWMPIAKEYDPLKAGSIDGTDEDPHDRAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEV      1 - 70
FSRYGDIRRLRLVRDLVTGFSKGYAFIEYKEERAVIKAYRDADGLVIDQHEIFVDYELERTLKGWIPRRL     71 - 140
GGGLGGKKESGQLRFGGRDRPFRKPINLPVVKNDLYREGKRERRERSRSRERHWDSRTRDRDHDRGREKR    141 - 210
WQEREPTRVWPDNDWERERDFRDDRIKGREKKERGK                                      211 - 246
//

Text Mined References (12)

PMID Year Title