Property Summary

NCBI Gene PubMed Count 16
PubMed Score 42.71
PubTator Score 8.32

Knowledge Summary

Patent (2,087)

Expression

  Differential Expression (19)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.021 4.1e-02
Multiple myeloma 1.585 1.9e-02
psoriasis -1.300 2.4e-12
osteosarcoma -1.404 2.1e-03
atypical teratoid / rhabdoid tumor -1.300 2.6e-05
medulloblastoma, large-cell -1.300 2.3e-03
autosomal dominant Emery-Dreifuss muscul... 1.031 9.4e-03
juvenile dermatomyositis 1.272 9.1e-11
non-small cell lung cancer -1.215 5.3e-18
intraductal papillary-mucinous carcinoma... -1.100 3.4e-03
lung cancer -1.700 5.0e-04
colon cancer -1.700 4.4e-03
interstitial cystitis 1.400 9.5e-04
lung adenocarcinoma -1.145 8.5e-08
aldosterone-producing adenoma -1.049 2.9e-02
subependymal giant cell astrocytoma -1.110 2.9e-02
Pick disease 1.100 2.9e-05
ovarian cancer -1.900 4.7e-08
dermatomyositis 1.300 1.4e-03

Gene RIF (3)

PMID Text
22874833 SNRK inhibits colon cancer cell proliferation through calcyclin-binding protein up-regulation and beta-catenin degradation, which results in reduced proliferation signaling.
22874833 These findings reveal a novel function for SNRK in the regulation of colon cancer cell proliferation and beta-catenin signaling.
15733851 SNRK could mediate some of the physiological effects of LKB1

AA Sequence

MAGFKRGYDGKIAGLYDLDKTLGRGHFAVVKLARHVFTGEKVAVKVIDKTKLDTLATGHLFQEVRCMKLV      1 - 70
QHPNIVRLYEVIDTQTKLYLILELGDGGDMFDYIMKHEEGLNEDLAKKYFAQIVHAISYCHKLHVVHRDL     71 - 140
KPENVVFFEKQGLVKLTDFGFSNKFQPGKKLTTSCGSLAYSAPEILLGDEYDAPAVDIWSLGVILFMLVC    141 - 210
GQPPFQEANDSETLTMIMDCKYTVPSHVSKECKDLITRMLQRDPKRRASLEEIENHPWLQGVDPSPATKY    211 - 280
NIPLVSYKNLSEEEHNSIIQRMVLGDIADRDAIVEALETNRYNHITATYFLLAERILREKQEKEIQTRSA    281 - 350
SPSNIKAQFRQSWPTKIDVPQDLEDDLTATPLSHATVPQSPARAADSVLNGHRSKGLCDSAKKDDLPELA    351 - 420
GPALSTVPPASLKPTASGRKCLFRVEEDEEEDEEDKKPMSLSTQVVLRRKPSVTNRLTSRKSAPVLNQIF    421 - 490
EEGESDDEFDMDENLPPKLSRLKMNIASPGTVHKRYHRRKSQGRGSSCSSSETSDDDSESRRRLDKDSGF    491 - 560
TYSWHRRDSSEGPPGSEGDGGGQSKPSNASGGVDKASPSENNAGGGSPSSGSGGNPTNTSGTTRRCAGPS    561 - 630
NSMQLASRSAGELVESLKLMSLCLGSQLHGSTKYIIDPQNGLSFSSVKVQEKSTWKMCISSTGNAGQVPA    631 - 700
VGGIKFFSDHMADTTTELERIKSKNLKNNVLQLPLCEKTISVNIQRNPKEGLLCASSPASCCHVI         701 - 765
//

Text Mined References (21)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22874833 2012 Snf1-related kinase inhibits colon cancer cell proliferation through calcyclin-binding protein-dependent reduction of ?-catenin.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15733851 2005 Identification of the sucrose non-fermenting related kinase SNRK, as a novel LKB1 substrate.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12234663 2002 Cloning and characterization of human and mouse SNRK sucrose non-fermenting protein (SNF-1)-related kinases.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
12087103 2002 Correlation of transcriptional repression by p21(SNFT) with changes in DNA.NF-AT complex interactions.
10930554 2000 SNRK, a member of the SNF1 family, is related to low K(+)-induced apoptosis of cultured rat cerebellar granule neurons.
10878360 2000 Repression of IL-2 promoter activity by the novel basic leucine zipper p21SNFT protein.
8654423 1996 Molecular cloning and characterization of a novel mammalian protein kinase harboring a homology domain that defines a subfamily of serine/threonine kinases.
7788527 1995 Prediction of the coding sequences of unidentified human genes. III. The coding sequences of 40 new genes (KIAA0081-KIAA0120) deduced by analysis of cDNA clones from human cell line KG-1.