Property Summary

NCBI Gene PubMed Count 68
PubMed Score 61.95
PubTator Score 59.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
gastric cancer 1.300 5.7e-04
hepatocellular carcinoma 1.100 1.9e-06
Multiple myeloma 1.033 5.7e-03
osteosarcoma 1.586 4.0e-03
group 4 medulloblastoma 2.400 5.3e-06
primitive neuroectodermal tumor 1.800 1.1e-04
tuberculosis -1.500 4.1e-05
pancreatic ductal adenocarcinoma liver m... 1.519 1.8e-03
non-small cell lung cancer -1.091 2.0e-10
Hydrolethalus syndrome 1.162 4.0e-02
Breast cancer 2.900 2.3e-02
pediatric high grade glioma 1.200 4.7e-03
pilocytic astrocytoma 1.300 1.9e-04
lung carcinoma -1.500 1.5e-18
spina bifida -1.699 4.7e-02
Pick disease 1.400 1.5e-06
ovarian cancer 2.500 9.1e-06

 GWAS Trait (1)

Gene RIF (45)

PMID Text
26743567 the findings of this study demonstrate that the downregulation of SnoN expression in hRPTECs under high-glucose conditions is mediated by the increased expression of Smurf2 through the TGF-b1/Smad signaling pathway.
26435193 SMURF2 is a critical target of USP15 in the TGF-beta signaling pathway.
26166038 Data show that miR15b mediates SMURF2 expression in pancreatic cancer and suggest miR15b as an oncogene by promoting epithelial-mesenchymal transition and SMURF2 as a tumor suppressor gene which expression is inhibited by miR15b in pancreatic cancer.
26126536 Methylation by PRMT1 may regulate Smurf2 stability and control TGF-beta signaling.
25524739 miR-424 regulates the myofibroblast differentiation during epithelial-to-mesenchymal transition by potentiating the TGF-beta signaling pathway, likely through Smurf2.
25438670 Studies on Smurf2 and Nedd4 show that the C2 domain has the potential to regulate E3 activity by maintaining the HECT domain in a low-activity state where its ability for transthiolation and noncovalent Ubiquitin binding are impaired.
25051198 Results suggest that elevated transcription and expression levels of ubiquitin ligase E3s WWP1, Smurf1 and Smurf2 genes may be the mechanisms of occurrence, development and metastasis of prostate cancer.
24803334 These results suggest a novel regulatory mechanism for YY1 function by Smurf2.
24729608 that Smurf2 is an important nonredundant negative regulator of virus-triggered type I IFN signaling by targeting VISA for K48-linked ubiquitination and degradation.
24709419 The SMURF2:UBCH5 complex is critical in maintaining KRAS protein stability.
24485087 Provide evidence of posttranscriptional downregulation of Smurf2 in triple-negative breast cancers, and demonstrate that the loss of RB function is involved in microRNA-mediated interference with Smurf2 translation.
24121673 Smurf2 mediates ubiquitination and degradation of YY1, a key germinal centre transcription factor.
23781096 This study showed that, by targeting SMURF2, NS3-4A appears to block the negative regulation of TGF-beta signaling, increasing the responsiveness of cells to TGF-beta.
23526793 Smurf2-mediated degradation of EZH2 enhances neuron differentiation and improves functional recovery after ischaemic stroke.
23250956 Depleting SMURF2 reduced MITF expression and substantially lowered the threshold for MEK inhibitor-induced apoptosis, and sensitized melanoma cells to the cytotoxic effects of selumetinib.
22624557 Smurf2 interacts with Smad7 to suppress TGF-beta-mediated liver fibrosis through the ubiquitin-dependent degradation of TbetaRI during the early period of liver fibrosis.
22378783 TGFbeta induces expression of Smad7, Smurf2, and SIK1, the products of which physically and functionally interlink to control the activity of this pathway.
22231558 tumor suppression function that maintains genomic stability by control of the epigenetic landscape of histone modifications through RNF20
22070932 In summary we established a new mechanism of IL17RB regulation-Smurf2 dependent degradation of its adaptor protein DAZAP2.
21967197 mediates degradation of ubiquitinated HSP27 through the ubiquitin-proteasome pathway
21953463 SMURF2 is a novel E3 ubiquitin ligase for KLF5 and negatively regulates KLF5 by targeting it for proteasomal degradation.
21945933 RLIM directly binds to Smurf2, enhancing TGF-beta responsiveness in osteosarcoma U2OS cells.
21750651 SMURF2-mediated protective ubiquitination of EGFR may be responsible for EGFR overexpression in certain tumors.
20819168 These findings suggest that Smurf2 plays a significant role in the pathomechanism of progressive supranuclear palsy
19898560 Inhibition of Smad signaling may be achieved at the transcriptional level through c-Ski/receptor-Smad/co-mediator Smad4 interactions--REVIEW
19805145 E3 ubiquitin-protein ligase constitutive photomorphogenesis protein 1 is needed for COP1 for degradation via the ubiquitin-proteasome pathway.
19557001 Data show that REDD1 is subject to ubiquitin-mediated degradation mediated by the CUL4A-DDB1-ROC1-beta-TRCP E3 ligase complex and through the activity of glycogen synthase kinase 3beta.
19481076 Smurf2-mediated upregulation of beta-catenin through induction of proteasomal degradation of GSK-beta in chondrocytes may activate articular chondrocyte maturation and associated alteration of gene expression, the early events of osteoarthritis.
19255252 Smurf2 promotes trophoblast cell migration and invasion, and this function may involve downregulation of TGF-beta type I receptor.
19155312 Results establish an important role for Smurf2 in breast cancer progression and indicate that Smurf2 is a novel regulator of breast cancer cell migration and invasion.
19122240 Pin1 negatively regulates TGF-beta signaling by down-regulating Smad2/3 protein levels via induction of Smurf2-mediated ubiquitin-proteasomal degradation.
18927080 two related E3 ubiquitin ligases, Smurf1 and Smurf2, act in the same direction in TGF-beta family signaling but play opposite roles in cell migration.
18852296 Smurf2 regulates the localization and stability of Mad2.
18842593 Inhibition of PI3K or mTOR reduced the level of Rap1B, which acts downstream of Rheb and mTOR. The ubiquitin E3 ligase Smurf2 mediates the restriction of Rap1B by initiating its degradation.
18821706 Smurf2 is up-regulated during Osteoarthritis in humans
18671942 These results suggest an important role for Smurf2 binding to TRAF2 in determining specific signalling outputs of TNF-R2.
18514338 A significant elevation in expression of SMURF2 in oral squamous cell carcinoma cells was seen in carbon and neon-irradiated cells.
18353873 dysregulation of Smurf2 could contribute to an aberrant TGF-beta/Smad signaling in the pathogenesis of kidney fibrosis
18181147 Smurf2 action may be a useful strategy for inhibition of cancer cell growth.
18052755 Ectopic expression of Smurf2 driven by the Col2a1 promoter accelerated the process of endochondral ossification including chondrocyte maturation and osteoblast differentiation through upregulation of beta-catenin
17719543 Autoinhibition of the HECT-type ubiquitin ligase SMURF2 through its C2 domain.
16641086 analysis of the WW domain recognition motif for the interaction of Smad7 and the E3 ubiquitin ligase Smurf2
16061177 A 2.1 A resolution X-ray crystal structure of the Smurf2 HECT domain reveals that it has a suboptimal E2 binding pocket that could be optimized by mutagenesis.
15862290 SMURF2 ubiquitin ligase is transcriptionally induced by TGFbeta.
15574587 Smurf2 recruits the Rb and p53 pathways for induction of cellular replicative senescence.

AA Sequence

MSNPGGRRNGPVKLRLTVLCAKNLVKKDFFRLPDPFAKVVVDGSGQCHSTDTVKNTLDPKWNQHYDLYIG      1 - 70
KSDSVTISVWNHKKIHKKQGAGFLGCVRLLSNAINRLKDTGYQRLDLCKLGPNDNDTVRGQIVVSLQSRD     71 - 140
RIGTGGQVVDCSRLFDNDLPDGWEERRTASGRIQYLNHITRTTQWERPTRPASEYSSPGRPLSCFVDENT    141 - 210
PISGTNGATCGQSSDPRLAERRVRSQRHRNYMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWH    211 - 280
DPRVPRDLSNINCEELGPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQQQ    281 - 350
QVVSLCPDDTECLTVPRYKRDLVQKLKILRQELSQQQPQAGHCRIEVSREEIFEESYRQVMKMRPKDLWK    351 - 420
RLMIKFRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAVNPEHLSYFHFVGRIM    421 - 490
GMAVFHGHYIDGGFTLPFYKQLLGKSITLDDMELVDPDLHNSLVWILENDITGVLDHTFCVEHNAYGEII    491 - 560
QHELKPNGKSIPVNEENKKEYVRLYVNWRFLRGIEAQFLALQKGFNEVIPQHLLKTFDEKELELIICGLG    561 - 630
KIDVNDWKVNTRLKHCTPDSNIVKWFWKAVEFFDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTI    631 - 700
HQIDACTNNLPKAHTCFNRIDIPPYESYEKLYEKLLTAIEETCGFAVE                          701 - 748
//

Text Mined References (72)

PMID Year Title
26743567 2016 The downregulation of SnoN expression in human renal proximal tubule epithelial cells under high-glucose conditions is mediated by an increase in Smurf2 expression through TGF-?1 signaling.
26435193 2015 USP15 regulates SMURF2 kinetics through C-lobe mediated deubiquitination.
26166038 2015 miR-15b promotes epithelial-mesenchymal transition by inhibiting SMURF2 in pancreatic cancer.
26126536 2015 Protein Arginine Methyltransferase 1 Methylates Smurf2.
25524739 2015 Regulation of myofibroblast differentiation by miR-424 during epithelial-to-mesenchymal transition.
25438670 2014 Structural and functional framework for the autoinhibition of Nedd4-family ubiquitin ligases.
25051198 2014 Bortezomib prevents oncogenesis and bone metastasis of prostate cancer by inhibiting WWP1, Smurf1 and Smurf2.
24803334 2014 Smurf2 regulates the degradation of YY1.
24729608 2014 Smurf2 negatively modulates RIG-I-dependent antiviral response by targeting VISA/MAVS for ubiquitination and degradation.
24709419 2014 KRAS protein stability is regulated through SMURF2: UBCH5 complex-mediated ?-TrCP1 degradation.
24485087 2014 Downregulation of Smurf2, a tumor-suppressive ubiquitin ligase, in triple-negative breast cancers: involvement of the RB-microRNA axis.
24121673 2013 Smurf2 suppresses B-cell proliferation and lymphomagenesis by mediating ubiquitination and degradation of YY1.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23781096 2013 Hepatitis C virus/human interactome identifies SMURF2 and the viral protease as critical elements for the control of TGF-? signaling.
23526793 2013 Smurf2-mediated degradation of EZH2 enhances neuron differentiation and improves functional recovery after ischaemic stroke.
23250956 2013 Effect of SMURF2 targeting on susceptibility to MEK inhibitors in melanoma.
22624557 2012 Overexpression of Smad ubiquitin regulatory factor 2 suppresses transforming growth factor-? mediated liver fibrosis.
22378783 2012 Transcriptional induction of salt-inducible kinase 1 by transforming growth factor ? leads to negative regulation of type I receptor signaling in cooperation with the Smurf2 ubiquitin ligase.
22231558 2012 A tumor suppressor function of Smurf2 associated with controlling chromatin landscape and genome stability through RNF20.
22070932 2012 Smurf2 regulates IL17RB by proteasomal degradation of its novel binding partner DAZAP2.
22045334 2011 Ablation of Smurf2 reveals an inhibition in TGF-? signalling through multiple mono-ubiquitination of Smad3.
21967197 2011 Ubiquitination of heat shock protein 27 is mediated by its interaction with Smad ubiquitination regulatory factor 2 in A549 cells.
21953463 2011 The E3 ubiquitin ligase SMAD ubiquitination regulatory factor 2 negatively regulates Krüppel-like factor 5 protein.
21945933 2011 RLIM interacts with Smurf2 and promotes TGF-? induced U2OS cell migration.
21750651 2011 Regulation of EGFR protein stability by the HECT-type ubiquitin ligase SMURF2.
21572392 2011 SCFFBXL¹? regulates BMP signalling by directing the degradation of HECT-type ubiquitin ligase Smurf1.
20819168 2011 Smad ubiquitination regulatory factor-2 in progressive supranuclear palsy.
20676133 2010 Multiple modification and protein interaction signals drive the Ring finger protein 11 (RNF11) E3 ligase to the endosomal compartment.
19898560 2009 c-Ski, Smurf2, and Arkadia as regulators of TGF-beta signaling: new targets for managing myofibroblast function and cardiac fibrosis.
19805145 2009 E3 ubiquitin ligase COP1 regulates the stability and functions of MTA1.
19557001 2009 REDD1, an inhibitor of mTOR signalling, is regulated by the CUL4A-DDB1 ubiquitin ligase.
19481076 2009 Smurf2 induces degradation of GSK-3beta and upregulates beta-catenin in chondrocytes: a potential mechanism for Smurf2-induced degeneration of articular cartilage.
19379695 2009 Regulation of planar cell polarity by Smurf ubiquitin ligases.
19343052 2009 Control of the activity of WW-HECT domain E3 ubiquitin ligases by NDFIP proteins.
19255252 2009 Smurf2 participates in human trophoblast cell invasion by inhibiting TGF-beta type I receptor.
19155312 2009 Smad ubiquitination regulatory factor 2 promotes metastasis of breast cancer cells by enhancing migration and invasiveness.
19122240 2009 Pin1 down-regulates transforming growth factor-beta (TGF-beta) signaling by inducing degradation of Smad proteins.
19028597 2009 Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.
18985028 2008 Hepatitis C virus infection protein network.
18927080 2008 Smurf2 induces ubiquitin-dependent degradation of Smurf1 to prevent migration of breast cancer cells.
18852296 2008 The HECT E3 ligase Smurf2 is required for Mad2-dependent spindle assembly checkpoint.
18842593 2008 Rheb and mTOR regulate neuronal polarity through Rap1B.
18821706 2008 Induction of an osteoarthritis-like phenotype and degradation of phosphorylated Smad3 by Smurf2 in transgenic mice.
18729074 2008 Identification of novel Smad2 and Smad3 associated proteins in response to TGF-beta1.
18671942 2008 Smurf2 is a TRAF2 binding protein that triggers TNF-R2 ubiquitination and TNF-R2-induced JNK activation.
18514338 2008 Susceptible genes and molecular pathways related to heavy ion irradiation in oral squamous cell carcinoma cells.
18448069 2008 AIMP1/p43 downregulates TGF-beta signaling via stabilization of smurf2.
18353873 2008 Smad ubiquitination regulatory factor-2 in the fibrotic kidney: regulation, target specificity, and functional implication.
18181147 2008 Suppression of human tumor cell proliferation by Smurf2-induced senescence.
18052755 2008 Overexpression of Smurf2 stimulates endochondral ossification through upregulation of beta-catenin.
17719543 2007 Autoinhibition of the HECT-type ubiquitin ligase Smurf2 through its C2 domain.
16641086 2006 An expanded WW domain recognition motif revealed by the interaction between Smad7 and the E3 ubiquitin ligase Smurf2.
16061177 2005 Regulation of Smurf2 ubiquitin ligase activity by anchoring the E2 to the HECT domain.
15862290 2005 Transcriptional induction of Smurf2 ubiquitin ligase by TGF-beta.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15621726 2004 Bone morphogenetic proteins.
15574587 2004 Smurf2 up-regulation activates telomere-dependent senescence.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15138260 2004 Transforming growth factor-beta stimulates p300-dependent RUNX3 acetylation, which inhibits ubiquitination-mediated degradation.
14755250 2004 An RNF11: Smurf2 complex mediates ubiquitination of the AMSH protein.
14722617 2004 Impaired Smad7-Smurf-mediated negative regulation of TGF-beta signaling in scleroderma fibroblasts.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14562029 2003 The RING-H2 protein RNF11 is overexpressed in breast cancer and is a target of Smurf2 E3 ligase.
12717440 2003 Distinct endocytic pathways regulate TGF-beta receptor signalling and turnover.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11389444 2001 TGF-beta induces assembly of a Smad2-Smurf2 ubiquitin ligase complex that targets SnoN for degradation.
11163210 2000 Smad7 binds to Smurf2 to form an E3 ubiquitin ligase that targets the TGF beta receptor for degradation.
11158580 2001 Regulation of Smad degradation and activity by Smurf2, an E3 ubiquitin ligase.
11016919 2000 Smurf2 is a ubiquitin E3 ligase mediating proteasome-dependent degradation of Smad2 in transforming growth factor-beta signaling.