Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.74
PubTator Score 4.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma -2.100 8.9e-08
cystic fibrosis 1.528 7.5e-05
glioblastoma 1.300 2.5e-02
medulloblastoma, large-cell -1.700 4.8e-03
tuberculosis -1.200 1.3e-03
pancreatic ductal adenocarcinoma liver m... -2.019 5.8e-03
lung cancer -2.300 8.2e-05
colon cancer -2.000 3.5e-04
interstitial cystitis 1.700 9.8e-06
ulcerative colitis -1.500 1.1e-05
ovarian cancer -1.800 2.5e-09
pituitary cancer -1.400 2.9e-03

Gene RIF (4)

PMID Text
26783088 Solved the structure of SMPDL3a revealing a calcineurin-like fold. A dimetal site, glycosylation pattern and a disulfide bond network are likely to be conserved also in aSMase. We show that the binuclear site of SMPDL3a is occupied by two Zn(2+) ions.
25288789 Data indicate that sphingomyelin phosphodiesterase acid-like 3A (SMPDL3A) is a nucleotide phosphodiesterase secreted from cholesterol-loaded macrophages.
22810003 the induction of SMPDL3A is liver X receptor-dependent and is restricted to human blood cells with no induction observed in mouse cellular systems.
12442002 ASML3a is involved in the process of bladder tumorigenesis

AA Sequence

MALVRALVCCLLTAWHCRSGLGLPVAPAGGRNPPPAIGQFWHVTDLHLDPTYHITDDHTKVCASSKGANA      1 - 70
SNPGPFGDVLCDSPYQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTDTVINVITNMTTTIQSLF     71 - 140
PNLQVFPALGNHDYWPQDQLPVVTSKVYNAVANLWKPWLDEEAISTLRKGGFYSQKVTTNPNLRIISLNT    141 - 210
NLYYGPNIMTLNKTDPANQFEWLESTLNNSQQNKEKVYIIAHVPVGYLPSSQNITAMREYYNEKLIDIFQ    211 - 280
KYSDVIAGQFYGHTHRDSIMVLSDKKGSPVNSLFVAPAVTPVKSVLEKQTNNPGIRLFQYDPRDYKLLDM    281 - 350
LQYYLNLTEANLKGESIWKLEYILTQTYDIEDLQPESLYGLAKQFTILDSKQFIKYYNYFFVSYDSSVTC    351 - 420
DKTCKAFQICAIMNLDNISYADCLKQLYIKHNY                                         421 - 453
//

Text Mined References (11)

PMID Year Title
26783088 2016 The structure and catalytic mechanism of human sphingomyelin phosphodiesterase like 3a--an acid sphingomyelinase homologue with a novel nucleotide hydrolase activity.
25288789 2014 Sphingomyelin phosphodiesterase acid-like 3A (SMPDL3A) is a novel nucleotide phosphodiesterase regulated by cholesterol in human macrophages.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22810003 2012 Regulation of sphingomyelin phosphodiesterase acid-like 3A gene (SMPDL3A) by liver X receptors.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12442002 2002 Increased expression of the acid sphingomyelinase-like protein ASML3a in bladder tumors.