Property Summary

NCBI Gene PubMed Count 17
PubMed Score 88.49
PubTator Score 50.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.452 7.8e-03
diabetes mellitus -1.600 1.7e-03
mucosa-associated lymphoid tissue lympho... -1.343 2.2e-02
pancreatic cancer 1.100 1.6e-02
dermatomyositis 1.200 8.1e-04

 GO Function (1)

Gene RIF (4)

PMID Text
22363433 The binding specificity and affinity of the Tudor domains of TDRD3, SMN and SPF30 proteins were characterized quantitatively.
22101937 The structures of SMN and SPF30 Tudor domains bound to symmetric and asymmetric dimethylated arginine (DMA) are presented.
18211889 U2AF35 and hPrp3 interactions with SPF30 can occur simultaneously, thereby potentially linking 3' splice site recognition with tri-small nuclear ribonucleoprotein addition
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPT      1 - 70
HSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEGRKAKEDSGNKPM     71 - 140
SKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVG    141 - 210
VGTCGIADKPMTQYQDTSKYNVRHLMPQ                                              211 - 238
//

Text Mined References (25)

PMID Year Title
23850713 2014 Genome-wide association study of Crohn's disease in Koreans revealed three new susceptibility loci and common attributes of genetic susceptibility across ethnic populations.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22363433 2012 Crystal structure of TDRD3 and methyl-arginine binding characterization of TDRD3, SMN and SPF30.
22101937 2011 Structural basis for dimethylarginine recognition by the Tudor domains of human SMN and SPF30 proteins.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18211889 2008 Splicing factor SPF30 bridges an interaction between the prespliceosome protein U2AF35 and tri-small nuclear ribonucleoprotein protein hPrp3.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15635413 2005 Nucleolar proteome dynamics.
15494309 2004 Coupled in vitro import of U snRNPs and SMN, the spinal muscular atrophy protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11331595 2001 SMNrp is an essential pre-mRNA splicing factor required for the formation of the mature spliceosome.
11331295 2001 SPF30 is an essential human splicing factor required for assembly of the U4/U5/U6 tri-small nuclear ribonucleoprotein into the spliceosome.
9817934 1998 Characterization of a gene encoding survival motor neuron (SMN)-related protein, a constituent of the spliceosome complex.
9731529 1998 Mass spectrometry and EST-database searching allows characterization of the multi-protein spliceosome complex.