Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma 1.233 2.2e-03
juvenile dermatomyositis 1.176 4.2e-10
primary pancreatic ductal adenocarcinoma 1.567 9.8e-04
breast carcinoma 1.400 3.5e-03
Breast cancer 3.600 2.5e-02
group 3 medulloblastoma 1.100 7.9e-03
ovarian cancer -1.500 3.0e-03
pancreatic cancer 1.500 7.6e-04

Synonym

Accession Q7Z3B0 B9EJC4
Symbols C5orf43

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MFDIKAWAEYVVEWAAKDPYGFLTTVILALTPLFLASAVLSWKLAKMIEAREKEQKKKQKRQENIAKAKR      1 - 70
LKKD                                                                       71 - 74
//

Text Mined References (5)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.